Property Summary

NCBI Gene PubMed Count 17
Grant Count 33
R01 Count 17
Funding $4,682,963.93
PubMed Score 310.26
PubTator Score 49.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus 1.100 0.001
Breast cancer -3.300 0.000
ulcerative colitis -1.400 0.002
psoriasis -1.300 0.000

Gene RIF (9)

PMID Text
21257749 cyclophilin isoform B is likely responsible for down-regulation of carrier expression by CsA and that it does so via its chaperone activity on NaDC1 (by direct interaction) rather than its rotamase activity.
20610529 study concludes most of the naturally occurring nonsynonymous SNPs affect protein processing of NaDC1; several also affect functional properties; mutations are predicted to decrease transport activity
20424473 Observational study of gene-disease association. (HuGE Navigator)
18161988 The Ser or Thr at position 509 is the most important determinant of functional differences in apparent affinity for substrate and cations. The cation and substrate binding sites are located in close proximity to one another.
17470169 Observational study of gene-disease association. (HuGE Navigator)
17470169 B allele of I550V polymorphism of hNaDC-1 may be associated with a reduction in urinary citrate excretion and contribute to hypocitraturia in recurrent renal stone formers.
15774465 there are conformationally sensitive residues in extracellular loop 5 of the Na+/dicarboxylate co-transporter
15620109 Data show that the sodium-dependent dicarboxylate co-transporter protein 1 is located in renal proximal tubule lumenal membranes, and that the C-terminal sequence is required for delivery and targeting and may contain the signal sequence.
12445824 This paper describes the cloning and functional characterization of the human Na(+)-coupled citrate transporter (NaCT).

AA Sequence

MATCWQALWAYRSYLIVFFVPILLLPLPILVPSKEAYCAYAIILMALFWCTEALPLAVTALFPLILFPMM      1 - 70
GIVDASEVAVEYLKDSNLLFFGGLLVAIAVEHWNLHKRIALRVLLIVGVRPAPLILGFMLVTAFLSMWIS     71 - 140
NTATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHL    141 - 210
SQKHLHLTQCMSLCVCYSASIGGIATLTGTAPNLVLQGQINSLFPQNGNVVNFASWFSFAFPTMVILLLL    211 - 280
AWLWLQILFLGFNFRKNFGIGEKMQEQQQAAYCVIQTEHRLLGPMTFAEKAISILFVILVLLWFTREPGF    281 - 350
FLGWGNLAFPNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLDWKTVNQKMPWN    351 - 420
IVLLLGGGYALAKGSERSGLSEWLGNKLTPLQSVPAPAIAIILSLLVATFTECTSNVATTTIFLPILASM    421 - 490
AQAICLHPLYVMLPCTLATSLAFMLPVATPPNAIVFSFGDLKVLDMARAGFLLNIIGVLIIALAINSWGI    491 - 560
PLFSLHSFPSWAQSNTTAQCLPSLANTTTPSP                                          561 - 592
//

Text Mined References (18)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21257749 2011 Synthesis, maturation, and trafficking of human Na+-dicarboxylate cotransporter NaDC1 requires the chaperone activity of cyclophilin B.
20610529 2010 Single nucleotide polymorphisms in the human Na+-dicarboxylate cotransporter affect transport activity and protein expression.
20424473 2010 L-type voltage-dependent calcium channel alpha subunit 1C is a novel candidate gene associated with secondary hyperparathyroidism: an application of haplotype-based analysis for multiple linked single nucleotide polymorphisms.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18161988 2008 Threonine-509 is a determinant of apparent affinity for both substrate and cations in the human Na+/dicarboxylate cotransporter.
17470169 2007 Associations between renal sodium-citrate cotransporter (hNaDC-1) gene polymorphism and urinary citrate excretion in recurrent renal calcium stone formers and normal controls.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16211368 2006 Molecular properties of the SLC13 family of dicarboxylate and sulfate transporters.
More...