Property Summary

NCBI Gene PubMed Count 19
PubMed Score 82.05
PubTator Score 49.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
Breast cancer 3578 1.7e-25
psoriasis 6694 6.7e-12
diabetes mellitus 1728 1.1e-03
ulcerative colitis 1819 1.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Nephrolithiasis 56 4.933 2.5
Metabolic acidosis 90 3.416 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer -3.300 1.7e-25
diabetes mellitus 1.100 1.1e-03
psoriasis -1.300 6.7e-12
ulcerative colitis -1.400 1.6e-03

Gene RIF (11)

AA Sequence

MATCWQALWAYRSYLIVFFVPILLLPLPILVPSKEAYCAYAIILMALFWCTEALPLAVTALFPLILFPMM      1 - 70
GIVDASEVAVEYLKDSNLLFFGGLLVAIAVEHWNLHKRIALRVLLIVGVRPAPLILGFMLVTAFLSMWIS     71 - 140
NTATSAMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSEGRAHL    141 - 210
SQKHLHLTQCMSLCVCYSASIGGIATLTGTAPNLVLQGQINSLFPQNGNVVNFASWFSFAFPTMVILLLL    211 - 280
AWLWLQILFLGFNFRKNFGIGEKMQEQQQAAYCVIQTEHRLLGPMTFAEKAISILFVILVLLWFTREPGF    281 - 350
FLGWGNLAFPNAKGESMVSDGTVAIFIGIIMFIIPSKFPGLTQDPENPGKLKAPLGLLDWKTVNQKMPWN    351 - 420
IVLLLGGGYALAKGSERSGLSEWLGNKLTPLQSVPAPAIAIILSLLVATFTECTSNVATTTIFLPILASM    421 - 490
AQAICLHPLYVMLPCTLATSLAFMLPVATPPNAIVFSFGDLKVLDMARAGFLLNIIGVLIIALAINSWGI    491 - 560
PLFSLHSFPSWAQSNTTAQCLPSLANTTTPSP                                          561 - 592
//

Text Mined References (20)

PMID Year Title