Property Summary

Ligand Count 7
NCBI Gene PubMed Count 113
PubMed Score 88.78
PubTator Score 126.36

Knowledge Summary

Patent (22,539)


  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.679 5.4e-07
adult high grade glioma 1.500 5.5e-04
Astrocytoma, Pilocytic 1.700 5.8e-07
atypical teratoid / rhabdoid tumor 2.800 8.3e-10
Breast cancer 2.000 2.8e-02
breast carcinoma 1.200 1.0e-19
ependymoma 1.500 1.6e-07
glioblastoma 1.400 3.1e-05
group 3 medulloblastoma 1.100 7.6e-03
intraductal papillary-mucinous neoplasm ... 1.500 3.9e-03
invasive ductal carcinoma 1.100 1.9e-02
juvenile dermatomyositis 1.259 5.2e-08
medulloblastoma, large-cell 2.600 6.1e-06
non-small cell lung cancer 1.252 1.8e-12
osteosarcoma -1.377 4.8e-04
ovarian cancer -1.200 4.4e-04
primitive neuroectodermal tumor 1.800 1.4e-04
psoriasis -4.100 4.3e-06
Waldenstrons macroglobulinemia 1.105 1.5e-02

Protein-protein Interaction (1)

Gene RIF (119)

AA Sequence

AKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR                                        491 - 524

Text Mined References (129)

PMID Year Title