Property Summary

NCBI Gene PubMed Count 108
PubMed Score 81.39
PubTator Score 126.36

Knowledge Summary

Patent (22,539)

TINX Plot

  Disease Sources (2)

Disease Target Count
Proteinuria 63
Schizophrenia 503
Disease Target Count P-value
breast carcinoma 1614 1.03419616275643E-19
non-small cell lung cancer 2798 1.79614178313096E-12
atypical teratoid / rhabdoid tumor 4369 8.25210530019662E-10
pediatric high grade glioma 2712 1.28377434498995E-8
juvenile dermatomyositis 1189 5.15148061666862E-8
glioblastoma 5572 7.24554735154941E-8
ependymoma 2514 1.61665405473262E-7
pilocytic astrocytoma 3086 4.67095572238486E-7
acute quadriplegic myopathy 1157 5.38185553405155E-7
group 4 medulloblastoma 1875 7.14654055206826E-7
psoriasis 6685 4.30689703595678E-6
ovarian cancer 8492 5.73208345936049E-6
medulloblastoma, large-cell 6234 6.06072464369378E-6
primitive neuroectodermal tumor 3031 1.36228325839218E-4
osteosarcoma 7933 4.76217669762956E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00390215828248003
Waldenstrons macroglobulinemia 765 0.0145079041306753
invasive ductal carcinoma 2950 0.0185633155569759
Breast cancer 3099 0.0277289402518278

Expression

Synonym

Accession Q13177 Q13154 Q6ISC3
Symbols PAK65
PAKgamma

Gene

PDB

3PCS  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (116)

PMID Text
26412398 PAK2 is a direct effector of TSC1-TSC2-RHEB signaling and a new target for rational drug therapy in TSC.
26363097 Findings indicate that repression of microRNA miR-134 and consequent up-regulation of p21-activated kinase 2 (Pak2) might contribute to paclitaxel resistance.
26350970 Nef exploits PAK2 in a stepwise mechanism in which its kinase activity cooperates with an adaptor function for the exocyst complex to inhibit host cell actin dynamics.
26350970 HIV-1 Nef requires the GTPase interaction site of PAK2 to facilitate interactions of Nef with EXOC
26218748 Cytoplasmic Pak2 may promote cell proliferation in normal endometrium during menstrual cycle.
26150340 Further analyses show that HDAC6 may promote growth of GBM cells through inhibition of SMAD2 phosphorylation to downregulate p21
26078008 Pak1 and Pak2 counteract centrosome separation in a kinase-dependent manner.
25807049 HIV-1 Nef requires the GTPase interaction site of PAK2 to facilitate interactions of Nef with EXOC
25596744 Data show that group I p21-activated kinases (Paks) Pak1 and Pak2 were much more abundant than Pak3 in meningioma.
25050916 Results identified Pak2 as a possibly important mediator of ovarian cancer cell migration on extracellular matrix.
More...

AA Sequence

MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRHKIISIFSGTEKGSKKKEKE      1 - 70
RPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLKFYDSNTVKQKYL     71 - 140
SFTPPEKDGFPSGTPALNAKGTEAPAVVTEEEDDDEETAPPVIAPRPDHTKSIYTRSVIDPVPAPVGDSH    141 - 210
VDGAAKSLDKQKKKTKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQI    211 - 280
NLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCR    281 - 350
ECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAY    351 - 420
GPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGS    421 - 490
AKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR                                        491 - 524
//

Text Mined References (124)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26412398 2015 PAK2 is an effector of TSC1/2 signaling independent of mTOR and a potential therapeutic target for Tuberous Sclerosis Complex.
26363097 2015 Down-regulated expression of miR-134 contributes to paclitaxel resistance in human ovarian cancer cells.
26350970 2015 Association with PAK2 Enables Functional Interactions of Lentiviral Nef Proteins with the Exocyst Complex.
26218748 2015 p21-Activated Kinases 1, 2 and 4 in Endometrial Cancers: Effects on Clinical Outcomes and Cell Proliferation.
26150340 2015 Histone deacetylase 6 promotes growth of glioblastoma through inhibition of SMAD2 signaling.
26078008 2015 Cdk1 phosphorylates the Rac activator Tiam1 to activate centrosomal Pak and promote mitotic spindle formation.
25596744 2015 Group I Paks as therapeutic targets in NF2-deficient meningioma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
More...