Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q13166
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MVLNEEIPRHLLLTQNNDIIPKHHILILPAVDSYQKSVNDLRALTFSKFQELKHAHELRNLCVSQSRFLA      1 - 70
IMWFGTNTN                                                                  71 - 79
//

Text Mined References (2)

PMID Year Title
10860668 2000 Construction of a physical and transcript map flanking the imprinted MEST/PEG1 region at 7q32.
7604004 1995 Cloning and sequencing of CATR1.3, a human gene associated with tumorigenic conversion.