Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q13166
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MVLNEEIPRHLLLTQNNDIIPKHHILILPAVDSYQKSVNDLRALTFSKFQELKHAHELRNLCVSQSRFLA      1 - 70
IMWFGTNTN                                                                  71 - 79
//

Text Mined References (3)

PMID Year Title