Property Summary

Ligand Count 13
NCBI Gene PubMed Count 59
PubMed Score 66.23
PubTator Score 53.06

Knowledge Summary

Patent (5,337)

Expression

  Differential Expression (3)

Disease log2 FC p
diabetes mellitus -1.300 5.0e-03
osteosarcoma -1.334 9.3e-07
tuberculosis 1.100 3.7e-05

Protein-protein Interaction (6)

Gene RIF (33)

AA Sequence

MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRI      1 - 70
TVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSL     71 - 140
PSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYHVPSGKILAVKVILLDITLELQKQIM    141 - 210
SELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKIL    211 - 280
HRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELA    281 - 350
LGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV    351 - 420
QFNDGNAAVVSMWVCRALEERRSQQGPP                                              421 - 448
//

Text Mined References (63)

PMID Year Title