Property Summary

NCBI Gene PubMed Count 56
Grant Count 59
R01 Count 41
Funding $2,181,279.28
PubMed Score 59.42
PubTator Score 53.06

Knowledge Summary

Patent (5,337)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.334 0.000
tuberculosis 1.300 0.000
diabetes mellitus -1.300 0.005

Synonym

Accession Q13163 B4DE43 Q92961 Q92962 MAP kinase kinase 5
Symbols MEK5
MAPKK5
PRKMK5
HsT17454

Gene

PDB

2O2V   2NPT   4IC7  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (30)

PMID Text
26498236 Our findings confirm an association between the BTBD9, MEIS1, and MAP2K5/SKOR1 SNPs and periodic limb movements of sleep in an elderly cohort.
25662172 High MEK5 expression is associated with colorectal cancer.
25637721 SEC16B, MC4R, MAP2K5 and KCTD15 (rs17782313, rs543874, rs2241423 and rs11084753) polymorphisms are associated with the risk for children obesity in China.
25142570 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD
24975362 Inhibitors of apoptosis proteins regulate myogenic differentiation by directly suppressing MEKK2/3-MEK5-ERK5 signaling.
24436253 MiR-330-3p and MAP2K5 are potentially important contributors to mood and anxiety-related traits
24205826 Specifically, CKS1B and MAP2K5 significantly inhibited hepatitis C viral RNA replication. PACSIN1, by contrast, inhibited hepatitis C virus infection by decreasing the level of viral protein p7.
23950888 MEK5/ERK5 signaling suppresses estrogen receptor expression and promotes hormone-independent tumorigenesis.
22594783 Single nucleotide polymorphism in the MAP2K5 gene is associated with BMI and obesity.
21925394 Variants in MEIS1, BTBD9, and MAP2K5/SKOR1 confer a significant risk of restless legs syndrome in a United States population.
More...

AA Sequence

MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRI      1 - 70
TVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSDSL     71 - 140
PSNSLKKSSAELKKILANGQMNEQDIRYRDTLGHGNGGTVYKAYHVPSGKILAVKVILLDITLELQKQIM    141 - 210
SELEILYKCDSSYIIGFYGAFFVENRISICTEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKIL    211 - 280
HRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELA    281 - 350
LGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPVGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV    351 - 420
QFNDGNAAVVSMWVCRALEERRSQQGPP                                              421 - 448
//

Text Mined References (60)

PMID Year Title
26498236 2015 Genetic associations of periodic limb movements of sleep in the elderly for the MrOS sleep study.
25662172 2015 SATB2 suppresses the progression of colorectal cancer cells via inactivation of MEK5/ERK5 signaling.
25637721 2015 Genetic variations in SEC16B, MC4R, MAP2K5 and KCTD15 were associated with childhood obesity and interacted with dietary behaviors in Chinese school-age population.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25142570 2014 Periodic leg movements during sleep are associated with polymorphisms in BTBD9, TOX3/BC034767, MEIS1, MAP2K5/SKOR1, and PTPRD.
24975362 2014 Ubiquitin-dependent regulation of MEKK2/3-MEK5-ERK5 signaling module by XIAP and cIAP1.
24861553 2014 Meta-analysis of genome-wide association studies in East Asian-ancestry populations identifies four new loci for body mass index.
24436253 2014 The effects of a MAP2K5 microRNA target site SNP on risk for anxiety and depressive disorders.
24205826 2014 Identification of novel human kinases that suppress hepatitis C virus infection.
More...