Property Summary

NCBI Gene PubMed Count 53
PubMed Score 109.00
PubTator Score 93.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
acute myeloid leukemia -1.200 1.4e-02
adult high grade glioma 1.400 1.4e-04
Amyotrophic lateral sclerosis 1.018 1.8e-05
astrocytoma 1.300 4.5e-15
Astrocytoma, Pilocytic 1.900 7.3e-09
atypical teratoid / rhabdoid tumor 1.600 1.5e-05
Breast cancer 3.200 4.9e-02
colon cancer 2.000 2.2e-02
diabetes mellitus -1.200 4.0e-02
ependymoma 1.700 1.3e-12
glioblastoma 1.900 9.0e-12
group 3 medulloblastoma 1.600 7.5e-05
interstitial cystitis 1.100 8.9e-03
intraductal papillary-mucinous adenoma (... -1.900 1.0e-03
intraductal papillary-mucinous carcinoma... -1.700 1.4e-02
intraductal papillary-mucinous neoplasm ... -1.800 1.6e-02
lung cancer 3.100 2.0e-05
medulloblastoma, large-cell 1.600 8.0e-05
non primary Sjogren syndrome sicca 1.300 3.0e-02
oligodendroglioma 1.400 9.1e-14
ovarian cancer -1.300 3.9e-04
pancreatic cancer -1.100 1.1e-03
pancreatic ductal adenocarcinoma liver m... -3.088 5.7e-03
ulcerative colitis 1.600 1.6e-05

Gene RIF (44)

AA Sequence

MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVA      1 - 70
DHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRS     71 - 140
INTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGI    141 - 210
LRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN             211 - 271
//

Text Mined References (57)

PMID Year Title