Property Summary

NCBI Gene PubMed Count 50
Grant Count 4
R01 Count 2
Funding $336,388
PubMed Score 101.47
PubTator Score 93.43

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13162 Q6FHT3
Symbols PRX-4
AOE372
AOE37-2
HEL-S-97n

Gene

PANTHER Protein Class (2)

PDB

2PN8   3TJB   3TJF   3TJG   3TJJ   3TJK   3TKP   3TKQ   3TKR   3TKS   4RQX  

Gene RIF (41)

PMID Text
26261544 Positive Prx 4 expression is significantly correlated with recurrence and shorter disease-free survival in patients with early-stage lung squamous cell carcinoma.
25137134 An off-pathway reaction in the Prx4-mediated oxidative protein folding.
25122762 these data suggest an important role of Prdx4 in maintaining insulin levels and improving the ER folding capacity also under conditions of a high insulin requirement.
24893865 Findings suggest that elevated serum Prx4 levels are associated with a higher risk of incident type 2 diabetes
24617620 there is a significant difference in concentration of Prx4 between cardiac arrest patients with good and poor outcome
24586984 Prx4 is a circulating antioxidant and is independently associated with increased risk of cardiovascular and all-cause mortality in T2DM.
24450625 The structure and function of PRDX4 as well as its sensitivity to hyperoxidation. [Review]
24403061 peroxiredoxin IV recycling in the endoplasmic reticulum is much less efficient than in the cytosol or mitochondria, leading to the protection of peroxiredoxin IV from hyperoxidation.
24098506 expression of PRDX4 in PCOS ovaries appeared to be mediated through oxidative stress in GCs. We reported that the deficiency of antioxidant PRDX4 was associated with pathophysiological mechanism of PCOS.
23979138 Data indicate that protein disulfide isomerase (PDI) and ERp44 dynamically localize Ero1alpha and peroxiredoxin 4 in early secretory compartment (ESC).
More...

AA Sequence

MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVA      1 - 70
DHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRS     71 - 140
INTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGI    141 - 210
LRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN             211 - 271
//

Text Mined References (54)

PMID Year Title
26261544 2015 Peroxiredoxin 4 as an independent prognostic marker for survival in patients with early-stage lung squamous cell carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25137134 2014 A novel reaction of peroxiredoxin 4 towards substrates in oxidative protein folding.
25122762 2014 Peroxiredoxin 4 improves insulin biosynthesis and glucose-induced insulin secretion in insulin-secreting INS-1E cells.
24893865 2014 Circulating peroxiredoxin 4 and type 2 diabetes risk: the Prevention of Renal and Vascular Endstage Disease (PREVEND) study.
24617620 2014 CT-proAVP (copeptin), MR-proANP and Peroxiredoxin 4 after cardiac arrest: release profiles and correlation to outcome.
24586984 2014 Serum peroxiredoxin 4: a marker of oxidative stress associated with mortality in type 2 diabetes (ZODIAC-28).
24450625 2014 Regulating the level of intracellular hydrogen peroxide: the role of peroxiredoxin IV.
24403061 2014 Lack of an efficient endoplasmic reticulum-localized recycling system protects peroxiredoxin IV from hyperoxidation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...