Property Summary

NCBI Gene PubMed Count 229
PubMed Score 469.81
PubTator Score 314.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
glioblastoma 1.100 1.3e-02
intraductal papillary-mucinous neoplasm ... 1.200 9.3e-03
ovarian cancer 1.300 8.1e-04
psoriasis 2.200 3.6e-05

Protein-protein Interaction (4)

Gene RIF (140)

AA Sequence

MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASL      1 - 70
RRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTER     71 - 140
VRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS      141 - 208
//

Text Mined References (237)

PMID Year Title