Property Summary

NCBI Gene PubMed Count 207
Grant Count 422
R01 Count 298
Funding $29,191,211
PubMed Score 451.88
PubTator Score 314.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis 2.200 0.000
glioblastoma 1.100 0.013
intraductal papillary-mucinous neoplasm ... 1.200 0.009
ovarian cancer 1.300 0.001

Synonym

Accession Q13158 Q14866 Q6IBR4
Symbols GIG3
MORT1

Gene

PDB

3EZQ   1A1W   1A1Z   1E3Y   1E41   2GF5   3OQ9  

Gene RIF (124)

PMID Text
26808319 TCGA analysis showed that ANO1 and FADD, located at 11q13, were co-expressed at transcript level and significantly associated with overall and disease-free survival
26437781 A20 targets caspase-8 and FADD to protect HTLV-I-infected cells.
26419589 Data (including data obtained in transgenic mice) suggest FADD is key in genesis of neural tube defects in pups of diabetic mice; unfolded protein response/endoplasmic reticulum stress was prevented by over-expression of human dominant negative FADD.
26253696 multifaceted kinase, CK2, phosphorylates FADD and is involved in its sub-cellular localization.
25643035 domains of calmodulin mediate FADD and TRADD interaction
25305096 high expression of FADD may be an independent biomarker for poor prognosis in nasopharyngeal carcinoma.
25129245 The gene expression analysis showed statistically significant difference between cases and healthy controls for both FADD (p<0.02) and FAS (p<0.007) genes
25075716 Observed upregulation of cortical p-194 FADD and p-FADD/FADD ratio (higher pro-survival index) in major depression; could play a major role to counteract the known activation of the intrinsic (mitochondrial) apoptotic pathway in the brain
24901053 depletion of alphaNAC in multiple types of cancer cells induce typical apoptotic cell death. This anti-apoptotic function is mediated by the FADD/c-Jun N-terminal kinase pathway.
24886289 Combined FADD, TMEM16A, and PPFIA1 gene expressions are associated with invasive ductal carcinoma of the breast.
More...

AA Sequence

MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASL      1 - 70
RRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTER     71 - 140
VRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS      141 - 208
//

Text Mined References (215)

PMID Year Title
26808319 2016 Meta-Analyses of Microarray Datasets Identifies ANO1 and FADD as Prognostic Markers of Head and Neck Cancer.
26437781 2016 A20 targets caspase-8 and FADD to protect HTLV-I-infected cells.
26419589 2015 Dominant negative FADD dissipates the proapoptotic signalosome of the unfolded protein response in diabetic embryopathy.
26253696 2015 Modulatory role of the anti-apoptotic protein kinase CK2 in the sub-cellular localization of Fas associated death domain protein (FADD).
25911380 2015 The seventh zinc finger motif of A20 is required for the suppression of TNF-?-induced apoptosis.
25643035 2015 N-terminal and C-terminal domains of calmodulin mediate FADD and TRADD interaction.
25305096 2014 Fatty acid synthase-associated protein with death domain: a prognostic factor for survival in patients with nasopharyngeal carcinoma.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25129245 2014 Analysis of methylation and mRNA expression status of FADD and FAS genes in patients with oral squamous cell carcinoma.
25075716 2014 FADD adaptor and PEA-15/ERK1/2 partners in major depression and schizophrenia postmortem brains: basal contents and effects of psychotropic treatments.
More...