Property Summary

NCBI Gene PubMed Count 13
PubMed Score 20.71
PubTator Score 10.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q13156 Q3SY03 RP-A p30
Symbols HSU24186

Gene

 GO Function (1)

Gene RIF (7)

PMID Text
19996105 Findings provide the first direct evidence for the function of alternative form of RPA in human DNA metabolism and support a model for aRPA functioning in chromosome maintenance functions in nonproliferating cells.
19942684 Results suggest that RPA4 cannot support cell proliferation but can support processes that maintain the genomic integrity of the cell.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18676680 Observational study of gene-disease association. (HuGE Navigator)
15929725 Hyperphosphorylated replication protein A is preferentially localized to double-stranded break repair and the DNA damage checkpoint complexes in response to DNA damage.
9084803 Replication protein A and HIV-1 nucleocapsid protein interfere with the strand displacement DNA synthesis of HIV-1 reverse transcriptase by binding to the displaced strand and keeping it away from the newly synthesized strand

AA Sequence

MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGII      1 - 70
VSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSL     71 - 140
EVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIH    141 - 210
ECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD                       211 - 261
//

Text Mined References (14)

PMID Year Title
20545304 2010 Functions of alternative replication protein A in initiation and elongation.
19996105 2010 An alternative form of replication protein a expressed in normal human tissues supports DNA repair.
19942684 2010 A naturally occurring human RPA subunit homolog does not support DNA replication or cell-cycle progression.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19116208 2009 An alternative form of replication protein a prevents viral replication in vitro.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15929725 2005 Preferential localization of hyperphosphorylated replication protein A to double-strand break repair and checkpoint complexes upon DNA damage.
15772651 2005 The DNA sequence of the human X chromosome.
More...