Property Summary

NCBI Gene PubMed Count 13
PubMed Score 22.32
PubTator Score 10.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
intraductal papillary-mucinous adenoma (... 1.300 1.4e-03
intraductal papillary-mucinous carcinoma... 1.800 4.0e-04
lung adenocarcinoma 2.000 1.3e-02
lung cancer -2.300 5.8e-03
ovarian cancer -1.800 8.0e-08
pancreatic cancer 1.100 1.3e-03
pancreatic carcinoma 1.100 1.3e-03

 GO Function (1)

Protein-protein Interaction (7)

Gene RIF (7)

AA Sequence

MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGII      1 - 70
VSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSL     71 - 140
EVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIH    141 - 210
ECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD                       211 - 261
//

Text Mined References (14)

PMID Year Title