Property Summary

NCBI Gene PubMed Count 49
Grant Count 12
Funding $1,110,986.49
PubMed Score 21.94
PubTator Score 25.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma 1.400 0.001
astrocytoma 1.200 0.005
medulloblastoma, large-cell 1.600 0.000
lung cancer 1.800 0.032
adult high grade glioma 1.100 0.000
group 3 medulloblastoma 1.300 0.000
non primary Sjogren syndrome sicca 1.200 0.019
lung adenocarcinoma 1.100 0.000
ovarian cancer 1.700 0.000

Gene RIF (15)

PMID Text
26472928 analysis of the heterotetrameric complex structure of the glutathione transferase (GST) domains shared among the four MSC components, methionyl-tRNA synthetase (MRS), glutaminyl-prolyl-tRNA synthetase (EPRS), AIMP2 and AIMP3
25320310 Ubiquitin and SUMO compete for the same lysine (K242) on influenza A virus M1 and the interaction of viral NS2 with human AIMP2 facilitates the switch of the M1 modification from ubiquitination to SUMOylation, thus increasing viral replication.
25010285 Interaction of HIV-1 Gag with aminoacyl tRNA synthetase complex-interacting multifunctional protein 2 (AIMP2) is identified in a series of six affinity purification/mass spectrometry screens
23974709 Transgeneic overexpression of AIMP2 led to a selective, age-dependent, progressive loss of dopaminergic neurons.
23815603 The tumorigenic activity of AIMP2-DX2 can be controlled by the small chemical BC-DXI01, which can selectively suppress the AIMP2-DX2 mRNA transcript.
22684553 These findings suggested that, although excessive accumulation of oxidative DNA damage was present in LSCs, the relatively decreased phosphorylation of p38 might help leukemic cells escape senescence and apoptosis.
22562359 downregulation of AIMP2 lacking exon 2 (AIMP2-DX2), expressed in different cancer cells, suppressed the epidermal growth factor receptor/mitogen activated protein kinase signaling pathway
22532625 AIMP2-DX2, a splicing variant of tumor suppressor AIMP2, can be a therapeutic target to control chemoresistant epithelial ovarian cancer .
22285955 ribozyme could selectively deliver the activity of a suicide gene into the AIMP2-DX2 RNA expressing lung cancer cells and thereby specifically and effectively retard the growth of the cancer cells with prodrug treatment.
22190034 Interaction of HIV-1 Gag with aminoacyl tRNA synthetase complex-interacting multifunctional protein 2 (AIMP2) is identified in a series of six affinity purification/mass spectrometry screens
More...

AA Sequence

MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELK      1 - 70
AAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHR     71 - 140
LLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGE    141 - 210
GNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVV    211 - 280
LWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK                                  281 - 320
//

Text Mined References (54)

PMID Year Title
27197155 2016 Oncogenic Mutation of AIMP2/p38 Inhibits Its Tumor-Suppressive Interaction with Smurf2.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26605883 2015 Corrigendum: Parthanatos mediates AIMP2-activated age-dependent dopaminergic neuronal loss.
26544075 2015 Evaluation of Multi-tRNA Synthetase Complex by Multiple Reaction Monitoring Mass Spectrometry Coupled with Size Exclusion Chromatography.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26472928 2015 Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains.
25416956 2014 A proteome-scale map of the human interactome network.
25320310 2015 Interaction of NS2 with AIMP2 facilitates the switch from ubiquitination to SUMOylation of M1 in influenza A virus-infected cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23974709 2013 Parthanatos mediates AIMP2-activated age-dependent dopaminergic neuronal loss.
More...