Tbio | Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 |
Required for assembly and stability of the aminoacyl-tRNA synthase complex. Mediates ubiquitination and degradation of FUBP1, a transcriptional activator of MYC, leading to MYC down-regulation which is required for aveolar type II cell differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.
The protein encoded by this gene is part of the aminoacyl-tRNA synthetase complex, which contains nine different aminoacyl-tRNA synthetases and three non-enzymatic factors. The encoded protein is one of the non-enzymatic factors and is required for assembly and stability of the complex. [provided by RefSeq, May 2016]
The protein encoded by this gene is part of the aminoacyl-tRNA synthetase complex, which contains nine different aminoacyl-tRNA synthetases and three non-enzymatic factors. The encoded protein is one of the non-enzymatic factors and is required for assembly and stability of the complex. [provided by RefSeq, May 2016]
Comments
Disease | Target Count | P-value |
---|---|---|
lung adenocarcinoma | 2714 | 9.9026341234221E-8 |
ovarian cancer | 8492 | 6.5579836805768E-6 |
medulloblastoma, large-cell | 6234 | 2.19987364753578E-5 |
adult high grade glioma | 2148 | 2.22351633278669E-5 |
group 3 medulloblastoma | 2254 | 2.90223211636573E-5 |
glioblastoma | 5572 | 0.00146495128521552 |
astrocytoma | 1493 | 0.00452122525727938 |
non primary Sjogren syndrome sicca | 840 | 0.0188232190296491 |
lung cancer | 4473 | 0.032310807919238 |
Disease | log2 FC | p |
---|---|---|
glioblastoma | 1.400 | 0.001 |
astrocytoma | 1.200 | 0.005 |
medulloblastoma, large-cell | 1.600 | 0.000 |
lung cancer | 1.800 | 0.032 |
adult high grade glioma | 1.100 | 0.000 |
group 3 medulloblastoma | 1.300 | 0.000 |
non primary Sjogren syndrome sicca | 1.200 | 0.019 |
lung adenocarcinoma | 1.100 | 0.000 |
ovarian cancer | 1.700 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG Inparanoid |
Anole lizard | OMA EggNOG Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
Fruitfly | OMA Inparanoid |
PMID | Text |
---|---|
26472928 | analysis of the heterotetrameric complex structure of the glutathione transferase (GST) domains shared among the four MSC components, methionyl-tRNA synthetase (MRS), glutaminyl-prolyl-tRNA synthetase (EPRS), AIMP2 and AIMP3 |
25320310 | Ubiquitin and SUMO compete for the same lysine (K242) on influenza A virus M1 and the interaction of viral NS2 with human AIMP2 facilitates the switch of the M1 modification from ubiquitination to SUMOylation, thus increasing viral replication. |
25010285 | Interaction of HIV-1 Gag with aminoacyl tRNA synthetase complex-interacting multifunctional protein 2 (AIMP2) is identified in a series of six affinity purification/mass spectrometry screens |
23974709 | Transgeneic overexpression of AIMP2 led to a selective, age-dependent, progressive loss of dopaminergic neurons. |
23815603 | The tumorigenic activity of AIMP2-DX2 can be controlled by the small chemical BC-DXI01, which can selectively suppress the AIMP2-DX2 mRNA transcript. |
22684553 | These findings suggested that, although excessive accumulation of oxidative DNA damage was present in LSCs, the relatively decreased phosphorylation of p38 might help leukemic cells escape senescence and apoptosis. |
22562359 | downregulation of AIMP2 lacking exon 2 (AIMP2-DX2), expressed in different cancer cells, suppressed the epidermal growth factor receptor/mitogen activated protein kinase signaling pathway |
22532625 | AIMP2-DX2, a splicing variant of tumor suppressor AIMP2, can be a therapeutic target to control chemoresistant epithelial ovarian cancer . |
22285955 | ribozyme could selectively deliver the activity of a suicide gene into the AIMP2-DX2 RNA expressing lung cancer cells and thereby specifically and effectively retard the growth of the cancer cells with prodrug treatment. |
22190034 | Interaction of HIV-1 Gag with aminoacyl tRNA synthetase complex-interacting multifunctional protein 2 (AIMP2) is identified in a series of six affinity purification/mass spectrometry screens |
More... |
MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELK 1 - 70 AAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHR 71 - 140 LLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGE 141 - 210 GNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVV 211 - 280 LWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK 281 - 320 //
PMID | Year | Title |
---|---|---|
27197155 | 2016 | Oncogenic Mutation of AIMP2/p38 Inhibits Its Tumor-Suppressive Interaction with Smurf2. |
27107012 | 2016 | Pooled-matrix protein interaction screens using Barcode Fusion Genetics. |
26605883 | 2015 | Corrigendum: Parthanatos mediates AIMP2-activated age-dependent dopaminergic neuronal loss. |
26544075 | 2015 | Evaluation of Multi-tRNA Synthetase Complex by Multiple Reaction Monitoring Mass Spectrometry Coupled with Size Exclusion Chromatography. |
26496610 | 2015 | A human interactome in three quantitative dimensions organized by stoichiometries and abundances. |
26472928 | 2015 | Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
25320310 | 2015 | Interaction of NS2 with AIMP2 facilitates the switch from ubiquitination to SUMOylation of M1 in influenza A virus-infected cells. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
23974709 | 2013 | Parthanatos mediates AIMP2-activated age-dependent dopaminergic neuronal loss. |
More... |