| Tbio | Aminoacyl tRNA synthase complex-interacting multifunctional protein 2 |
Required for assembly and stability of the aminoacyl-tRNA synthase complex. Mediates ubiquitination and degradation of FUBP1, a transcriptional activator of MYC, leading to MYC down-regulation which is required for aveolar type II cell differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53/TP53. Functions as a proapoptotic factor.
The protein encoded by this gene is part of the aminoacyl-tRNA synthetase complex, which contains nine different aminoacyl-tRNA synthetases and three non-enzymatic factors. The encoded protein is one of the non-enzymatic factors and is required for assembly and stability of the complex. [provided by RefSeq, May 2016]
The protein encoded by this gene is part of the aminoacyl-tRNA synthetase complex, which contains nine different aminoacyl-tRNA synthetases and three non-enzymatic factors. The encoded protein is one of the non-enzymatic factors and is required for assembly and stability of the complex. [provided by RefSeq, May 2016]
Comments
Property Summary
| NCBI Gene PubMed Count | 49 |
| Grant Count | 12 |
| Funding | $1,110,986.49 |
| PubMed Score | 21.94 |
| PubTator Score | 25.11 |
| Disease | log2 FC | p |
|---|---|---|
| glioblastoma | 1.400 | 0.001 |
| astrocytoma | 1.200 | 0.005 |
| medulloblastoma, large-cell | 1.600 | 0.000 |
| lung cancer | 1.800 | 0.032 |
| adult high grade glioma | 1.100 | 0.000 |
| group 3 medulloblastoma | 1.300 | 0.000 |
| non primary Sjogren syndrome sicca | 1.200 | 0.019 |
| lung adenocarcinoma | 1.100 | 0.000 |
| ovarian cancer | 1.700 | 0.000 |
| PMID | Text |
|---|---|
| 26472928 | analysis of the heterotetrameric complex structure of the glutathione transferase (GST) domains shared among the four MSC components, methionyl-tRNA synthetase (MRS), glutaminyl-prolyl-tRNA synthetase (EPRS), AIMP2 and AIMP3 |
| 25320310 | Ubiquitin and SUMO compete for the same lysine (K242) on influenza A virus M1 and the interaction of viral NS2 with human AIMP2 facilitates the switch of the M1 modification from ubiquitination to SUMOylation, thus increasing viral replication. |
| 25010285 | Interaction of HIV-1 Gag with aminoacyl tRNA synthetase complex-interacting multifunctional protein 2 (AIMP2) is identified in a series of six affinity purification/mass spectrometry screens |
| 23974709 | Transgeneic overexpression of AIMP2 led to a selective, age-dependent, progressive loss of dopaminergic neurons. |
| 23815603 | The tumorigenic activity of AIMP2-DX2 can be controlled by the small chemical BC-DXI01, which can selectively suppress the AIMP2-DX2 mRNA transcript. |
| 22684553 | These findings suggested that, although excessive accumulation of oxidative DNA damage was present in LSCs, the relatively decreased phosphorylation of p38 might help leukemic cells escape senescence and apoptosis. |
| 22562359 | downregulation of AIMP2 lacking exon 2 (AIMP2-DX2), expressed in different cancer cells, suppressed the epidermal growth factor receptor/mitogen activated protein kinase signaling pathway |
| 22532625 | AIMP2-DX2, a splicing variant of tumor suppressor AIMP2, can be a therapeutic target to control chemoresistant epithelial ovarian cancer . |
| 22285955 | ribozyme could selectively deliver the activity of a suicide gene into the AIMP2-DX2 RNA expressing lung cancer cells and thereby specifically and effectively retard the growth of the cancer cells with prodrug treatment. |
| 22190034 | Interaction of HIV-1 Gag with aminoacyl tRNA synthetase complex-interacting multifunctional protein 2 (AIMP2) is identified in a series of six affinity purification/mass spectrometry screens |
| More... |
MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELK 1 - 70 AAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHR 71 - 140 LLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFSIQTMCPIEGE 141 - 210 GNIARFLFSLFGQKHNAVNATLIDSWVDIAIFQLKEGSSKEKAAVFRSMNSALGKSPWLAGNELTVADVV 211 - 280 LWSVLQQIGGCSVTVPANVQRWMRSCENLAPFNTALKLLK 281 - 320 //
| PMID | Year | Title |
|---|---|---|
| 27197155 | 2016 | Oncogenic Mutation of AIMP2/p38 Inhibits Its Tumor-Suppressive Interaction with Smurf2. |
| 27107012 | 2016 | Pooled-matrix protein interaction screens using Barcode Fusion Genetics. |
| 26605883 | 2015 | Corrigendum: Parthanatos mediates AIMP2-activated age-dependent dopaminergic neuronal loss. |
| 26544075 | 2015 | Evaluation of Multi-tRNA Synthetase Complex by Multiple Reaction Monitoring Mass Spectrometry Coupled with Size Exclusion Chromatography. |
| 26496610 | 2015 | A human interactome in three quantitative dimensions organized by stoichiometries and abundances. |
| 26472928 | 2015 | Assembly of Multi-tRNA Synthetase Complex via Heterotetrameric Glutathione Transferase-homology Domains. |
| 25416956 | 2014 | A proteome-scale map of the human interactome network. |
| 25320310 | 2015 | Interaction of NS2 with AIMP2 facilitates the switch from ubiquitination to SUMOylation of M1 in influenza A virus-infected cells. |
| 24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
| 23974709 | 2013 | Parthanatos mediates AIMP2-activated age-dependent dopaminergic neuronal loss. |
| More... |
