Property Summary

NCBI Gene PubMed Count 323
Grant Count 298
R01 Count 217
Funding $17,112,519.42
PubMed Score 228.63
PubTator Score 357.05

Knowledge Summary

Patent (25,992)

Expression

Synonym

Accession Q13153 O75561 Q13567 Q32M53 Q32M54 Q86W79
Symbols PAKalpha

Gene

PDB

2QME   1ZSG   1F3M   1YHV   1YHW   2HY8   3DVP   3FXZ   3FY0   3Q4Z   3Q52   3Q53   4DAW   4EQC   4O0R   4O0T   4P90   4ZJI   4ZJJ   4ZLO   4ZY4   4ZY5   4ZY6   5DEW   5DEY   5DFP   5IME  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
2374 other 1 / 0 / 0 PAK-Effector Pull-down Assay for Quantification of Rac/Cdc42 Activation Using 3T3 Cells

Gene RIF (236)

PMID Text
27012601 Data show association of G protein-coupled receptor kinase-interacting protein 1 (GIT1), p21-activated kinase interacting exchange factor (betaPIX), and p21 protein (Cdc42/Rac)-activated kinase 1 (PAK1) with centrosomes.
27003261 PAK1 nuclear translocation is ligand-dependent: only PRL but not E2 stimulated PAK1 nuclear translocation
26809475 Formation of filopodia by membrane glycoprotein M6a (Gpm6a) requires actin regulator coronin-1a (Coro1a), known to regulate plasma membrane localization and activation of Rac1 and its downstream effector Pak1.
26774265 Combination of a PAK1 inhibitor such as FRAX597 with cytotoxic chemotherapy deserves further study as a novel therapeutic approach to pancreatic cancer treatment.
26547035 Data indicate that NOTCH1 receptor intracellular domain (NOTCH1-IC) physically interacts with serine-threonine-protein kinase PAK 1 (PAK1) in intact cells.
26379399 beta-elemene enhances radiosensitivity of gastric cancer cells by inhibiting Pak1 signaling.
26377044 These findings indicate that genetic variants in PAK1 gene may contribute to susceptibility to lung cancer in the Chinese population.
26255026 Cx43 increases serum induced filopodia formation via activation of p21-activated protein kinase 1.
26218748 Pak1 promote endometrial cancer cell proliferation.
26160174 There is a major role of the CK2alpha-interacting protein CKIP-1 in activation of PAK1 for neoplastic prostate cells transformation.
More...

AA Sequence

MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILPGDKTNKKKEK      1 - 70
ERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKNPQAVLDVLEFYNSKKTSNSQ     71 - 140
KYMSFTDKSAEDYNSSNALNVKAVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTKSVYTRSVIEPLP    141 - 210
VTPTRDVATSPISPTENNTTPPDALTRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGA    211 - 280
SGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGG    281 - 350
SLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSK    351 - 420
RSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKL    421 - 490
SAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH                   491 - 545
//

Text Mined References (341)

PMID Year Title
27012601 2016 GIT1/?PIX signaling proteins and PAK1 kinase regulate microtubule nucleation.
27003261 2016 PAK1 translocates into nucleus in response to prolactin but not to estrogen.
26809475 2016 Neuronal filopodium formation induced by the membrane glycoprotein M6a (Gpm6a) is facilitated by coronin-1a, Rac1, and p21-activated kinase 1 (Pak1).
26774265 2016 FRAX597, a PAK1 inhibitor, synergistically reduces pancreatic cancer growth when combined with gemcitabine.
26547035 2016 NOTCH1 intracellular domain negatively regulates PAK1 signaling pathway through direct interaction.
26379399 2015 ?-elemene enhances the radiosensitivity of gastric cancer cells by inhibiting Pak1 activation.
26377044 2015 Potentially functional polymorphisms in PAK1 are associated with risk of lung cancer in a Chinese population.
26255026 2015 Cx43 increases serum induced filopodia formation via activation of p21-activated protein kinase 1.
26218748 2015 p21-Activated Kinases 1, 2 and 4 in Endometrial Cancers: Effects on Clinical Outcomes and Cell Proliferation.
26160174 2015 The Role of the Pleckstrin Homology Domain-containing Protein CKIP-1 in Activation of p21-activated Kinase 1 (PAK1).
More...