Property Summary

NCBI Gene PubMed Count 21
PubMed Score 6.45
PubTator Score 4.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession Q13151 Q6IB18 hnRNP A0
Symbols HNRPA0

Gene

Gene RIF (7)

PMID Text
26602816 Data show that heterogeneous nuclear ribonucleoprotein A0 (hnRNPA0) drives chemo-resistance of p53-mutant tumor cells via p27Kip1/Gadd45alpha mRNAs.
24532040 Knockdown of Hnrnpa0, a del(5q) gene, alters myeloid cell fate in murine cells through regulation of AU-rich transcripts.
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein A0 (HNRNPA0), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein A0 (HNRNPA0), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein A0 (HNRNPA0), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein A0 (HNRNPA0), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.

AA Sequence

MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPH      1 - 70
AVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRG     71 - 140
FGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGGRDQNGLS    141 - 210
KGGGGGYNSYGGYGGGGGGGYNAYGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSS    211 - 280
WGGRSNSGPYRGGYGGGGGYGGSSF                                                 281 - 305
//

Text Mined References (29)

PMID Year Title
26602816 2015 A Pleiotropic RNA-Binding Protein Controls Distinct Cell Cycle Checkpoints to Drive Resistance of p53-Defective Tumors to Chemotherapy.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24532040 2014 Knockdown of Hnrnpa0, a del(5q) gene, alters myeloid cell fate in murine cells through regulation of AU-rich transcripts.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...