Property Summary

NCBI Gene PubMed Count 21
PubMed Score 6.45
PubTator Score 4.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer -1.600 4.2e-21
group 3 medulloblastoma 1.100 1.3e-02
lung adenocarcinoma -1.400 1.6e-15
ovarian cancer -2.200 4.0e-07
subependymal giant cell astrocytoma -2.159 1.4e-02
tuberculosis and treatment for 6 months -1.200 5.1e-03
Waldenstrons macroglobulinemia 1.462 4.6e-03

Gene RIF (4)

AA Sequence

MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPH      1 - 70
AVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRG     71 - 140
FGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGGRDQNGLS    141 - 210
KGGGGGYNSYGGYGGGGGGGYNAYGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSS    211 - 280
WGGRSNSGPYRGGYGGGGGYGGSSF                                                 281 - 305
//

Text Mined References (30)

PMID Year Title