| Tbio | Heterogeneous nuclear ribonucleoprotein A0 |
mRNA-binding component of ribonucleosomes. Specifically binds AU-rich element (ARE)-containing mRNAs. Involved in post-transcriptional regulation of cytokines mRNAs.
This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus. [provided by RefSeq, Jul 2008]
This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus. [provided by RefSeq, Jul 2008]
Comments
| Disease | Target Count | P-value |
|---|---|---|
| Breast cancer | 3578 | 4.2e-21 |
| lung adenocarcinoma | 2716 | 1.6e-15 |
| ovarian cancer | 8520 | 4.0e-07 |
| Waldenstrons macroglobulinemia | 765 | 4.6e-03 |
| tuberculosis and treatment for 6 months | 409 | 5.1e-03 |
| group 3 medulloblastoma | 4104 | 1.3e-02 |
| subependymal giant cell astrocytoma | 2287 | 1.4e-02 |
| Disease | log2 FC | p |
|---|---|---|
| Breast cancer | -1.600 | 4.2e-21 |
| group 3 medulloblastoma | 1.100 | 1.3e-02 |
| lung adenocarcinoma | -1.400 | 1.6e-15 |
| ovarian cancer | -2.200 | 4.0e-07 |
| subependymal giant cell astrocytoma | -2.159 | 1.4e-02 |
| tuberculosis and treatment for 6 months | -1.200 | 5.1e-03 |
| Waldenstrons macroglobulinemia | 1.462 | 4.6e-03 |
| Species | Source | Disease |
|---|---|---|
| Inparanoid OMA | ||
| Inparanoid OMA | ||
| Inparanoid OMA | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA | ||
| Inparanoid OMA | ||
| OMA EggNOG | ||
| Inparanoid OMA EggNOG | ||
| Inparanoid OMA |
MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPH 1 - 70 AVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRG 71 - 140 FGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGGRDQNGLS 141 - 210 KGGGGGYNSYGGYGGGGGGGYNAYGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSS 211 - 280 WGGRSNSGPYRGGYGGGGGYGGSSF 281 - 305 //
