Tbio | Heterogeneous nuclear ribonucleoprotein A0 |
mRNA-binding component of ribonucleosomes. Specifically binds AU-rich element (ARE)-containing mRNAs. Involved in post-transcriptional regulation of cytokines mRNAs.
This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus. [provided by RefSeq, Jul 2008]
This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind RNAs, followed by a glycine-rich C-terminus. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | P-value |
---|---|---|
Breast cancer | 3099 | 4.24364433700426E-21 |
lung adenocarcinoma | 2714 | 1.637931276708E-15 |
ovarian cancer | 8492 | 3.99697878824195E-7 |
group 3 medulloblastoma | 2254 | 3.22119725071257E-4 |
Waldenstrons macroglobulinemia | 765 | 0.00463271334940829 |
tuberculosis and treatment for 6 months | 686 | 0.00514981735635579 |
subependymal giant cell astrocytoma | 2287 | 0.0143728846424492 |
Disease | log2 FC | p |
---|---|---|
Waldenstrons macroglobulinemia | 1.462 | 0.005 |
group 3 medulloblastoma | 2.000 | 0.000 |
tuberculosis and treatment for 6 months | -1.200 | 0.005 |
subependymal giant cell astrocytoma | -2.159 | 0.014 |
lung adenocarcinoma | -1.400 | 0.000 |
Breast cancer | -1.600 | 0.000 |
ovarian cancer | -2.200 | 0.000 |
Species | Source |
---|---|
Mouse | OMA Inparanoid |
Cow | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
26602816 | Data show that heterogeneous nuclear ribonucleoprotein A0 (hnRNPA0) drives chemo-resistance of p53-mutant tumor cells via p27Kip1/Gadd45alpha mRNAs. |
24532040 | Knockdown of Hnrnpa0, a del(5q) gene, alters myeloid cell fate in murine cells through regulation of AU-rich transcripts. |
23125841 | Tandem affinity purification and mass spectrometry analysis identify heterogeneous nuclear ribonucleoprotein A0 (HNRNPA0), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells |
19165527 | Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. |
MENSQLCKLFIGGLNVQTSESGLRGHFEAFGTLTDCVVVVNPQTKRSRCFGFVTYSNVEEADAAMAASPH 1 - 70 AVDGNTVELKRAVSREDSARPGAHAKVKKLFVGGLKGDVAEGDLIEHFSQFGTVEKAEIIADKQSGKKRG 71 - 140 FGFVYFQNHDAADKAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGGRDQNGLS 141 - 210 KGGGGGYNSYGGYGGGGGGGYNAYGGGGGGSSYGGSDYGNGFGGFGSYSQHQSSYGPMKSGGGGGGGGSS 211 - 280 WGGRSNSGPYRGGYGGGGGYGGSSF 281 - 305 //
PMID | Year | Title |
---|---|---|
26602816 | 2015 | A Pleiotropic RNA-Binding Protein Controls Distinct Cell Cycle Checkpoints to Drive Resistance of p53-Defective Tumors to Chemotherapy. |
25218447 | 2014 | Uncovering global SUMOylation signaling networks in a site-specific manner. |
24532040 | 2014 | Knockdown of Hnrnpa0, a del(5q) gene, alters myeloid cell fate in murine cells through regulation of AU-rich transcripts. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
24129315 | 2014 | Immunoaffinity enrichment and mass spectrometry analysis of protein methylation. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
22681889 | 2012 | The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts. |
22658674 | 2012 | Insights into RNA biology from an atlas of mammalian mRNA-binding proteins. |
22223895 | 2012 | Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features. |
21406692 | 2011 | System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. |
More... |