Property Summary

NCBI Gene PubMed Count 425
Grant Count 450
R01 Count 139
Funding $66,388,330.71
PubMed Score 1213.01
PubTator Score 1144.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.238 0.005
osteosarcoma -1.046 0.000
astrocytoma 1.300 0.006
juvenile dermatomyositis 1.048 0.000
diabetes mellitus 2.400 0.001
lung carcinoma 1.300 0.000
acute myeloid leukemia 2.500 0.012
ovarian cancer 1.500 0.001
dermatomyositis 1.800 0.001

Synonym

Gene

PDB

1WF0   2CQG   2N2C   2N3X   2N4G   2N4H   2N4P   4BS2   4IUF   4Y00   4Y0F  

Gene RIF (421)

PMID Text
27040765 TDP-43 does have dynamic inter-domain interactions, which are coordinated by the intrinsically-disordered prion-like domain.
26971127 TDP-43 pathology in the basal forebrain is strongly associated with hippocampal sclerosis-aging.
26902425 Data suggest that TRIM16 and TDP43 are both good prognosis indicators; data shows that TRIM16 inhibits cancer cell viability by a novel mechanism involving interaction and stabilisation of TDP43 with consequent effects on E2F1 and pRb proteins.
26769969 Expression of truncated hyperactive form of CKIdelta causes mislocalization and aggregation of TDP-43 in cultured cells.
26756435 Data indicate that the structure of TAR DNA-binding protein-43 (TDP-43)consists of an alpha-helix and six beta-strands.
26735904 prion-like domain appears to have an energy landscape to allow the self-assembly of reversible and functional oligomers only under limited conditions
26702100 data indicate that impaired mTORC1 signaling and influenced ALP may contribute to TDP-43-mediated neurodegeneration.
26605911 Study identifies a common mechanism of transport into neurites of proteins linked to the pathology of Alzheimer's disease (i.e. sAPP) and ALS (i.e. FUS, TDP-43 and SOD1)
26598621 TDP-43 may be bidirectionally and vertically transmitted across synaptic terminals.
26571498 TDP-43 may play an important role in regulating the levels of NF-kappaB activity by controlling the nuclear translocation of p65.
More...

AA Sequence

MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGN      1 - 70
LVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLK     71 - 140
TGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREF    141 - 210
FSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNP    211 - 280
GGFGNQGGFGNSRGGGAGLGNNQGSNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPS    281 - 350
GNNQNQGNMQREPNQAFGSGNNSYSGSNSGAAIGWGSASNAGSGSGFNGGFGSSMDSKSSGWGM          351 - 414
//

Text Mined References (435)

PMID Year Title
27040765 2016 Inter-domain interactions of TDP-43 as decoded by NMR.
26971127 2016 Hippocampal Sclerosis but Not Normal Aging or Alzheimer Disease Is Associated With TDP-43 Pathology in the Basal Forebrain of Aged Persons.
26902425 2016 High TDP43 expression is required for TRIM16-induced inhibition of cancer cell growth and correlated with good prognosis of neuroblastoma and breast cancer patients.
26769969 2016 Phosphorylation of TAR DNA-binding Protein of 43 kDa (TDP-43) by Truncated Casein Kinase 1? Triggers Mislocalization and Accumulation of TDP-43.
26756435 2016 The TDP-43 N-terminal domain structure at high resolution.
26735904 2016 ALS-Causing Mutations Significantly Perturb the Self-Assembly and Interaction with Nucleic Acid of the Intrinsically Disordered Prion-Like Domain of TDP-43.
26702100 2016 TDP-43 loss of function increases TFEB activity and blocks autophagosome-lysosome fusion.
26605911 2016 Shared Molecular Mechanisms in Alzheimer's Disease and Amyotrophic Lateral Sclerosis: Neurofilament-Dependent Transport of sAPP, FUS, TDP-43 and SOD1, with Endoplasmic Reticulum-Like Tubules.
26598621 2015 TDP-43 is intercellularly transmitted across axon terminals.
26571498 2015 TDP-43 Inhibits NF-?B Activity by Blocking p65 Nuclear Translocation.
More...