Property Summary

NCBI Gene PubMed Count 31
Grant Count 10
R01 Count 5
Funding $366,736.16
PubMed Score 118.83
PubTator Score 51.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
psoriasis -1.200 0.000
glioblastoma 1.300 0.017
cystic fibrosis -1.627 0.000
group 4 medulloblastoma -1.600 0.000
intraductal papillary-mucinous adenoma (... -1.400 0.012
lung cancer 3.300 0.000
colon cancer 2.900 0.000
interstitial cystitis -2.100 0.000
pilocytic astrocytoma 2.800 0.000
aldosterone-producing adenoma -1.378 0.041
lung carcinoma 3.300 0.000
ductal carcinoma in situ 2.200 0.022
invasive ductal carcinoma 3.500 0.001
ovarian cancer -3.100 0.000

Gene RIF (21)

PMID Text
26258650 TGFbeta target genes including TGFBI, BAMBI, COL3A1 and SERPINE1 are significantly increased in Diamond Blackfan Anemia induced pluripotent stem cells
24912656 betacatenin expression was downregulated as a result of knocking down of BAMBI, and TGF-beta was downregulated in a similar manner.
24798646 The observations illuminated that BAMBI inhibits adipogenesis by a feedback loop (BAMBI-->beta-catenin nuclear translocation-->BAMBI), which forms with Wnt/beta-catenin signaling.
24752577 BAMBI alone or in combination with Smad7 was significantly associated with the OS and DFS. These findings suggest that BAMBI and Smad7 may cooperatively inhibit the TGF-beta signaling, and thus promote the progression of gastric cancer.
24448807 study demonstrates that LPS- and TNF-alpha-induced NF-kappaBp50-HDAC1 interaction represses BAMBI transcriptional activity, which contributes to TLR4-mediated enhancement of TGF-beta signaling in hepatic stellate cells during liver fibrosis.
23807684 Overexpression of BAMBI is associated with the growth and invasion of human osteosarcoma.
22406377 Metformin-mediated Bambi expression in hepatic stellate cells induces prosurvival Wnt/beta-catenin signaling
22187378 Alterations in BAMBI may play a role in the (patho)physiology of obesity, and manipulation of BAMBI may present a novel therapeutic approach to improve adipose tissue function.
21496456 Data show that hepatoprotective effects of adiponectin include induction of BAMBI which is reduced in human fatty liver.
20886049 BAMBI protein is expressed in endothelial cells and is regulated by autophagy and lysosomal degradation.
More...

AA Sequence

MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCL      1 - 70
DSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQ     71 - 140
ELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAK    141 - 210
LDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV                        211 - 260
//

Text Mined References (31)

PMID Year Title
26258650 2015 Dysregulation of the Transforming Growth Factor ? Pathway in Induced Pluripotent Stem Cells Generated from Patients with Diamond Blackfan Anemia.
24912656 2014 Knockdown of BAMBI inhibits ?-catenin and transforming growth factor ? to suppress metastasis of gastric cancer cells.
24798646 2014 BMP and activin membrane-bound inhibitor (BAMBI) inhibits the adipogenesis of porcine preadipocytes through Wnt/?-catenin signaling pathway.
24752577 2014 Expression of BAMBI and its combination with Smad7 correlates with tumor invasion and poor prognosis in gastric cancer.
24448807 2014 Transcriptional repression of the transforming growth factor ? (TGF-?) Pseudoreceptor BMP and activin membrane-bound inhibitor (BAMBI) by Nuclear Factor ?B (NF-?B) p50 enhances TGF-? signaling in hepatic stellate cells.
23807684 2013 The overexpression of BAMBI and its involvement in the growth and invasion of human osteosarcoma cells.
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
22406377 2012 Metformin-mediated Bambi expression in hepatic stellate cells induces prosurvival Wnt/?-catenin signaling.
22187378 2012 Identification of BMP and activin membrane-bound inhibitor (BAMBI) as a potent negative regulator of adipogenesis and modulator of autocrine/paracrine adipogenic factors.
21496456 2011 Adiponectin induces the transforming growth factor decoy receptor BAMBI in human hepatocytes.
More...