Property Summary

NCBI Gene PubMed Count 32
PubMed Score 138.01
PubTator Score 51.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
aldosterone-producing adenoma -1.378 4.1e-02
Astrocytoma, Pilocytic 2.800 8.9e-09
colon cancer 2.900 1.3e-04
cystic fibrosis -1.627 1.1e-06
ductal carcinoma in situ 2.200 2.2e-02
glioblastoma 1.300 1.7e-02
group 4 medulloblastoma -1.600 1.4e-05
interstitial cystitis -1.800 6.0e-04
intraductal papillary-mucinous adenoma (... -1.400 1.2e-02
invasive ductal carcinoma 3.500 5.9e-04
lung cancer 3.100 1.4e-04
lung carcinoma 3.300 1.2e-45
malignant mesothelioma -1.400 6.4e-07
ovarian cancer -3.100 3.3e-12
psoriasis -1.200 5.5e-06

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (22)

AA Sequence

MDRHSSYIFIWLQLELCAMAVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCL      1 - 70
DSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQ     71 - 140
ELTSSKELWFRAAVIAVPIAGGLILVLLIMLALRMLRSENKRLQDQRQQMLSRLHYSFHGHHSKKGQVAK    141 - 210
LDLECMVPVSGHENCCLTCDKMRQADLSNDKILSLVHWGMYSGHGKLEFV                        211 - 260
//

Text Mined References (32)

PMID Year Title