Property Summary

NCBI Gene PubMed Count 53
PubMed Score 82.14
PubTator Score 62.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
malignant mesothelioma 3232 2.9e-07
osteosarcoma 7950 2.1e-05
ovarian cancer 8520 8.5e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 1.5
substance-related disorder 162 0.0 1.7
Disease Target Count Z-score Confidence
Leukodystrophy 55 0.0 4.0
Disease Target Count Z-score Confidence
Cerebellar Ataxia 304 3.024 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.500 2.9e-07
osteosarcoma -1.334 2.1e-05
ovarian cancer 1.100 8.5e-04

Gene RIF (27)

AA Sequence

MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPISKDQPRVLLPL      1 - 70
ANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVVRIITSELYRSLGDVLRDVDA     71 - 140
KALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSVMTMIFKESSPSHPTRCHEDNVVVAVDSTTN    141 - 210
RVLHFQKTQGLRRFAFPLSLFQGSSDGVEVRYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNE    211 - 280
EILGNQIHMHVTAKEYGARVSNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSL    281 - 350
GHGSILEENVLLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK    351 - 420
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKMKGYNPAEVGA    421 - 490
AGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGT    491 - 560
LQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSP    561 - 630
VFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKN    631 - 700
QQLQRFIQWLKEAEEESSEDD                                                     701 - 721
//

Text Mined References (69)

PMID Year Title