Property Summary

NCBI Gene PubMed Count 44
PubMed Score 234.00
PubTator Score 25.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 1.1e-11
medulloblastoma, large-cell 6241 1.5e-04
lung cancer 4740 1.3e-03
adult high grade glioma 3801 1.3e-03
Multiple myeloma 1332 3.5e-03
Breast cancer 3578 3.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 3.064 1.5

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.100 1.3e-03
Breast cancer -1.800 3.3e-02
lung cancer -2.100 1.3e-03
medulloblastoma, large-cell 1.300 1.5e-04
Multiple myeloma 1.059 3.5e-03
ovarian cancer 1.300 1.1e-11

Gene RIF (23)

AA Sequence

MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYY      1 - 70
TFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQG     71 - 140
EVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELL    141 - 210
QLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQK    211 - 280
KLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMG    281 - 350
LDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCF    351 - 420
NCPICDKIFPATEKQIFEDHVFCHSL                                                421 - 446
//

Text Mined References (49)

PMID Year Title