Property Summary

NCBI Gene PubMed Count 37
Grant Count 20
R01 Count 3
Funding $1,100,963.97
PubMed Score 214.91
PubTator Score 25.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.059 0.004
medulloblastoma, large-cell 1.300 0.000
lung cancer -2.100 0.001
Breast cancer -1.800 0.033
adult high grade glioma 1.100 0.001
ovarian cancer -1.700 0.000

Gene RIF (20)

PMID Text
26506893 insight into how CALCOCO2 targets ubiquitin-decorated pathogens for autophagic degradations
26493630 Presence of the NDP52 rs2303015 minor variant increases the risk for spontaneous bacterial peritonitis in patients with alcoholic cirrhosis.
26266977 two receptors previously linked to xenophagy, NDP52 and optineurin, are the primary receptors for PINK1- and parkin-mediated mitophagy
25771791 These data show that NDP52 promotes the maturation of autophagosomes via its interaction with LC3A, LC3B, and/or GABARAPL2 through a distinct LC3-interacting region, and with MYOSIN VI.
25366815 control retrotransposon insertion in the genome
25033267 data support a model in which non-ND10 resident Sp100 acts as a negative regulator of polycomb repressive complex-2 (PRC2) recruitment, and suggest that KSHV may actively escape ND10 silencing mechanisms to promote establishment of latent chromatin.
24453968 the role of ORF75 in the antagonization of ND10-mediated intrinsic immunity
23624108 The missense SNP rs2303015 (Val248Ala) in the NDP52 was associated with Crohn's disease.
23511477 Dimeric NDP52 forms a ternary complex with two monomeric galectin-8 molecules as well as two LC3C molecules
23386746 Data indicate that the binding site in galectin-8 is essential for the recruitment of the autophagy receptor NDP52 to cytosol-exposed Salmonella Typhimurium.
More...

AA Sequence

MEETIKDPPTSAVLLDHCHFSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYY      1 - 70
TFMWVTLPIDLNNKSAKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVTTQG     71 - 140
EVEEIEQHNKELCKENQELKDSCISLQKQNSDMQAELQKKQEELETLQSINKKLELKVKEQKDYWETELL    141 - 210
QLKEQNQKMSSENEKMGIRVDQLQAQLSTQEKEMEKLVQGDQDKTEQLEQLKKENDHLFLSLTEQRKDQK    211 - 280
KLEQTVEQMKQNETTAMKKQQELMDENFDLSKRLSENEIICNALQRQKERLEGENDLLKRENSRLLSYMG    281 - 350
LDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPLSIKKCPICKADDICDHTLEQQQMQPLCF    351 - 420
NCPICDKIFPATEKQIFEDHVFCHSL                                                421 - 446
//

Text Mined References (42)

PMID Year Title
26506893 2015 Molecular basis of ubiquitin recognition by the autophagy receptor CALCOCO2.
26493630 2016 A variant in the nuclear dot protein 52kDa gene increases the risk for spontaneous bacterial peritonitis in patients with alcoholic liver cirrhosis.
26266977 2015 The ubiquitin kinase PINK1 recruits autophagy receptors to induce mitophagy.
25771791 2015 Autophagy receptor NDP52 regulates pathogen-containing autophagosome maturation.
25416956 2014 A proteome-scale map of the human interactome network.
25366815 2014 Autophagy supports genomic stability by degrading retrotransposon RNA.
25033267 2014 Influence of ND10 components on epigenetic determinants of early KSHV latency establishment.
24453968 2014 Kaposi's sarcoma associated herpesvirus tegument protein ORF75 is essential for viral lytic replication and plays a critical role in the antagonization of ND10-instituted intrinsic immunity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23624108 2013 Association between variants of PRDM1 and NDP52 and Crohn's disease, based on exome sequencing and functional studies.
More...