Property Summary

NCBI Gene PubMed Count 31
Grant Count 16
R01 Count 7
Funding $2,398,292.76
PubMed Score 40.20
PubTator Score 45.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Rheumatoid Arthritis 1.200 0.005
pancreatic cancer 1.100 0.001
ependymoma 2.100 0.006
oligodendroglioma 2.000 0.004
psoriasis 1.100 0.001
astrocytoma 1.200 0.000
glioblastoma multiforme 1.100 0.000
osteosarcoma 1.663 0.000
medulloblastoma, large-cell -1.200 0.023
tuberculosis -1.200 0.000
non-small cell lung cancer 1.540 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.001
intraductal papillary-mucinous carcinoma... 1.300 0.008
intraductal papillary-mucinous neoplasm ... 1.300 0.004
lung cancer 1.500 0.005
pancreatic carcinoma 1.100 0.001
Pick disease 1.400 0.000
gastric carcinoma 1.200 0.008
ovarian cancer -2.400 0.000
Gaucher disease type 1 -1.200 0.012
pituitary cancer -1.100 0.014
dermatomyositis 1.500 0.001

Gene RIF (14)

PMID Text
26362536 HIV-1 Gag interacts with PFFIA1 as demonstrated by proximity dependent biotinylation proteomics
25492966 results suggested that PPFIA1 functioned with PP2A to promote the dephosphorylation of Kif7, triggering Kif7 localization to the tips of primary cilia and promoting Gli transcriptional activity.
24982445 Liprin-alpha1, ERC1a and LL5 also define new highly polarized and dynamic cytoplasmic structures uniquely localized near the protruding cell edge
23453270 PPFIA1 was frequently co-amplified with the Cyclin D1 gene in oral carcinomas and could present a biomarker as well as a novel target for specific gene therapy.
22295056 PPFIA1 as a potential functional candidate acute lung injury risk gene
22072677 The results of this study finding suggested that a model by which the self-assembly of SYD-2/Liprin-alpha proteins mediated by the coiled-coil LH1 domain is one of the key steps to the accumulation of presynaptic components at nascent synaptic junctions
21157931 These results suggest that an increased expression of Liprin-alpha1 in the brain may be associated with human Intractable epilepsy .
20096687 Data show that increased levels of liprin-alpha1 affected the localization of inactive, low-affinity integrins, while increasing the average size of beta1 integrin-positive focal adhesions.
19787783 Amplification of both PPFIA1 and CCND1 were significantly associated with high-grade breast cancer phenotype but were unrelated to tumor stage or nodal stage
19690048 Liprin is an essential regulator of cell motility that contributes to the effectiveness of cell-edge protrusion.
More...

AA Sequence

MMCEVMPTISEAEGPPGGGGGHGSGSPSQPDADSHFEQLMVSMLEERDRLLDTLRETQETLALTQGKLHE      1 - 70
VGHERDSLQRQLNTALPQEFAALTKELNVCREQLLEREEEIAELKAERNNTRLLLEHLECLVSRHERSLR     71 - 140
MTVVKRQAQSPAGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERCSLLEEELGATHKELMILKEQN    141 - 210
NQKKTLTDGVLDINHEQENTPSTSGKRSSDGSLSHEEDLAKVIELQEIISKQSREQSQMKERLASLSSHV    211 - 280
TELEEDLDTARKDLIKSEEMNTKLQRDVREAMAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENEI    281 - 350
ANKDSMHRQTEDKNRQLQERLELAEQKLQQTLRKAETLPEVEAELAQRVAALSKAEERHGNIEERLRQME    351 - 420
AQLEEKNQELQRARQREKMNEEHNKRLSDTVDKLLSESNERLQLHLKERMAALEDKNSLLREVESAKKQL    421 - 490
EETQHDKDQLVLNIEALRAELDHMRLRGASLHHGRPHLGSVPDFRFPMADGHTDSYSTSAVLRRPQKGRL    491 - 560
AALRDEPSKVQTLNEQDWERAQQASVLANVAQAFESDADVSDGEDDRDTLLSSVDLLSPSGQADAHTLAM    561 - 630
MLQEQLDAINKEIRLIQEEKENTEQRAEEIESRVGSGSLDNLGRFRSMSSIPPYPASSLASSSPPGSGRS    631 - 700
TPRRIPHSPAREVDRLGVMTLLPPSREEVRDDKTTIKCETSPPSSPRALRLDRLHKGALHTVSHEDIRDI    701 - 770
RNSTGSQDGPVSNPSSSNSSQDSLHKAPKKKGIKSSIGRLFGKKEKGRPGQTGKEALGQAGVSETDNSSQ    771 - 840
DALGLSKLGGQAEKNRKLQKKHELLEEARRQGLPFAQWDGPTVVVWLELWVGMPAWYVAACRANVKSGAI    841 - 910
MSALSDTEIQREIGISNPLHRLKLRLAIQEIMSLTSPSAPPTSRTTLAYGDMNHEWIGNEWLPSLGLPQY    911 - 980
RSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRNSFQCGIMCLRRLNYDRKELERKREESQSEIKDVLV    981 - 1050
WSNDRVIRWILSIGLKEYANNLIESGVHGALLALDETFDFSALALLLQIPTQNTQARAVLEREFNNLLVM   1051 - 1120
GTDRRFDEDDDKSFRRAPSWRKKFRPKDIRGLAAGSAETLPANFRVTSSMSSPSMQPKKMQMDGNVSGTQ   1121 - 1190
RLDSATVRTYSC                                                             1191 - 1202
//

Text Mined References (41)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25492966 2014 The PPFIA1-PP2A protein complex promotes trafficking of Kif7 to the ciliary tip and Hedgehog signaling.
25416956 2014 A proteome-scale map of the human interactome network.
24982445 2014 Liprin-?1, ERC1 and LL5 define polarized and dynamic structures that are implicated in cell migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23453270 2013 Amplification of the PPFIA1 gene region on 11q13 in oral squamous cell carcinomas (OSCC).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22295056 2012 Genome wide association identifies PPFIA1 as a candidate gene for acute lung injury risk following major trauma.
22266902 2012 Liprin-? controls stress fiber formation by binding to mDia and regulating its membrane localization.
22072677 2011 The Liprin homology domain is essential for the homomeric interaction of SYD-2/Liprin-? protein in presynaptic assembly.
More...