Property Summary

NCBI Gene PubMed Count 34
PubMed Score 43.97
PubTator Score 45.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytoma 1.200 2.3e-10
dermatomyositis 1.500 7.2e-04
ependymoma 1.300 1.9e-02
gastric carcinoma 1.200 8.1e-03
Gaucher disease type 1 -1.200 1.2e-02
glioblastoma multiforme 1.100 1.4e-10
intraductal papillary-mucinous adenoma (... 1.300 5.4e-04
intraductal papillary-mucinous carcinoma... 1.300 7.9e-03
intraductal papillary-mucinous neoplasm ... 1.200 5.2e-03
lung cancer 1.500 4.6e-03
medulloblastoma, large-cell -1.200 2.3e-02
non-small cell lung cancer 1.540 5.0e-10
oligodendroglioma 1.300 1.8e-02
osteosarcoma 1.599 2.2e-06
ovarian cancer -1.400 4.8e-05
pancreatic cancer 1.100 1.1e-03
pancreatic carcinoma 1.100 1.1e-03
Pick disease 1.400 2.8e-04
pituitary cancer -1.100 1.4e-02
psoriasis 1.100 5.4e-04
Rheumatoid arthritis 1.200 4.5e-03
tuberculosis -1.200 1.1e-04

Protein-protein Interaction (3)

Gene RIF (17)

AA Sequence

MMCEVMPTISEAEGPPGGGGGHGSGSPSQPDADSHFEQLMVSMLEERDRLLDTLRETQETLALTQGKLHE      1 - 70
VGHERDSLQRQLNTALPQEFAALTKELNVCREQLLEREEEIAELKAERNNTRLLLEHLECLVSRHERSLR     71 - 140
MTVVKRQAQSPAGVSSEVEVLKALKSLFEHHKALDEKVRERLRVALERCSLLEEELGATHKELMILKEQN    141 - 210
NQKKTLTDGVLDINHEQENTPSTSGKRSSDGSLSHEEDLAKVIELQEIISKQSREQSQMKERLASLSSHV    211 - 280
TELEEDLDTARKDLIKSEEMNTKLQRDVREAMAQKEDMEERITTLEKRYLAAQREATSVHDLNDKLENEI    281 - 350
ANKDSMHRQTEDKNRQLQERLELAEQKLQQTLRKAETLPEVEAELAQRVAALSKAEERHGNIEERLRQME    351 - 420
AQLEEKNQELQRARQREKMNEEHNKRLSDTVDKLLSESNERLQLHLKERMAALEDKNSLLREVESAKKQL    421 - 490
EETQHDKDQLVLNIEALRAELDHMRLRGASLHHGRPHLGSVPDFRFPMADGHTDSYSTSAVLRRPQKGRL    491 - 560
AALRDEPSKVQTLNEQDWERAQQASVLANVAQAFESDADVSDGEDDRDTLLSSVDLLSPSGQADAHTLAM    561 - 630
MLQEQLDAINKEIRLIQEEKENTEQRAEEIESRVGSGSLDNLGRFRSMSSIPPYPASSLASSSPPGSGRS    631 - 700
TPRRIPHSPAREVDRLGVMTLLPPSREEVRDDKTTIKCETSPPSSPRALRLDRLHKGALHTVSHEDIRDI    701 - 770
RNSTGSQDGPVSNPSSSNSSQDSLHKAPKKKGIKSSIGRLFGKKEKGRPGQTGKEALGQAGVSETDNSSQ    771 - 840
DALGLSKLGGQAEKNRKLQKKHELLEEARRQGLPFAQWDGPTVVVWLELWVGMPAWYVAACRANVKSGAI    841 - 910
MSALSDTEIQREIGISNPLHRLKLRLAIQEIMSLTSPSAPPTSRTTLAYGDMNHEWIGNEWLPSLGLPQY    911 - 980
RSYFMECLVDARMLDHLTKKDLRGQLKMVDSFHRNSFQCGIMCLRRLNYDRKELERKREESQSEIKDVLV    981 - 1050
WSNDRVIRWILSIGLKEYANNLIESGVHGALLALDETFDFSALALLLQIPTQNTQARAVLEREFNNLLVM   1051 - 1120
GTDRRFDEDDDKSFRRAPSWRKKFRPKDIRGLAAGSAETLPANFRVTSSMSSPSMQPKKMQMDGNVSGTQ   1121 - 1190
RLDSATVRTYSC                                                             1191 - 1202
//

Text Mined References (44)

PMID Year Title