Property Summary

NCBI Gene PubMed Count 234
Grant Count 67
R01 Count 42
Funding $5,445,137.93
PubMed Score 115.46
PubTator Score 299.79

Knowledge Summary

Patent (6,521)

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis -1.500 0.000
osteosarcoma -1.876 0.009
adrenocortical carcinoma -1.250 0.003
tuberculosis 1.100 0.001
active Crohn's disease -1.493 0.003
active ulcerative colitis -1.109 0.007
ductal carcinoma in situ -1.100 0.017
invasive ductal carcinoma -1.200 0.011
head and neck cancer and chronic obstruc... 1.100 0.000

Synonym

Accession Q13133 A8K3J9 D3DQR1 Q8IW13 Q96H87
Symbols LXRA
LXR-a
RLD-1

Gene

PDB

1UHL   3IPQ   3IPS   3IPU   5AVI   5AVL   5HJS  

  TechDev Info (2)

Steve Finkbeiner Neuron specific phenotypes being screened
Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (208)

PMID Text
26814197 these data identify a new mechanism of LXR regulation that involves TIPARP, ADP-ribosylation and MACROD1.
26692490 In conclusion, our data indicate that HNF-4alpha may have a wider role in cell and plasma cholesterol homeostasis by controlling the expression of LXRalpha in hepatic cells.
26669941 LXR-alpha might downregulate S1PR2 expression via miR-130a-3p in quiescent HUVECs. Stimulation of TNF-alpha attenuates the activity of LXR-alpha and results in enhanced S1PR2 expression.
26602218 Intestinal activation of LXR reduces the production of chylomicrons by a mechanism dependent on the apical localization of SR-B1.
26595172 Studied the role of LXRalpha with Wnt/beta-catenin signaling in adipogenesis of MSCs.
26469385 HIV-1 MA activates NR1H3 signaling in primary hepatocytes
26469385 HIV-1 MA activates NR1H3 signaling in primary hepatocytes
26469385 HIV-1 MA activates NR1H3 signaling in primary hepatocytes
26379423 Suggest that blocking cholesterol deposition and inhibiting the LXRalpha pathway-induced inflammatory response might be one of the main mechanisms by which anthocyanins exert their protective effects in diabetic nephropathy.
26261553 Lipoxin A4 increases ABCA1 expression and promotes cholesterol efflux through LXRalpha pathway in THP-1 macrophage-derived foam cells.
More...

AA Sequence

MSLWLGAPVPDIPPDSAVELWKPGAQDASSQAQGGSSCILREEARMPHSAGGTAGVGLEAAEPTALLTRA      1 - 70
EPPSEPTEIRPQKRKKGPAPKMLGNELCSVCGDKASGFHYNVLSCEGCKGFFRRSVIKGAHYICHSGGHC     71 - 140
PMDTYMRRKCQECRLRKCRQAGMREECVLSEEQIRLKKLKRQEEEQAHATSLPPRASSPPQILPQLSPEQ    141 - 210
LGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAHFTELAIVSVQEIVDFAKQLPGFLQ    211 - 280
LSREDQIALLKTSAIEVMLLETSRRYNPGSESITFLKDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQ    281 - 350
LNDAEFALLIAISIFSADRPNVQDQLQVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSV    351 - 420
HSEQVFALRLQDKKLPPLLSEIWDVHE                                               421 - 447
//

Text Mined References (235)

PMID Year Title
26814197 2016 TCDD-inducible poly-ADP-ribose polymerase (TIPARP/PARP7) mono-ADP-ribosylates and co-activates liver X receptors.
26692490 2016 Transcriptional regulation of the human Liver X Receptor ? gene by Hepatocyte Nuclear Factor 4?.
26669941 2016 Liver X receptor-? and miR-130a-3p regulate expression of sphingosine 1-phosphate receptor 2 in human umbilical vein endothelial cells.
26602218 2016 Liver X Receptor Regulates Triglyceride Absorption Through Intestinal Down-regulation of Scavenger Receptor Class B, Type 1.
26595172 2016 Nuclear hormone receptor LXR? inhibits adipocyte differentiation of mesenchymal stem cells with Wnt/beta-catenin signaling.
26379423 2015 Anthocyanins inhibit high-glucose-induced cholesterol accumulation and inflammation by activating LXR? pathway in HK-2 cells.
26261553 2015 Lipoxin A4 promotes ABCA1 expression and cholesterol efflux through the LXR? signaling pathway in THP-1 macrophage-derived foam cells.
26160456 2015 Cardiac LXR? protects against pathological cardiac hypertrophy and dysfunction by enhancing glucose uptake and utilization.
26120082 2015 Broad Anti-tumor Activity of a Small Molecule that Selectively Targets the Warburg Effect and Lipogenesis.
25980575 2015 Activation of liver X receptors inhibits cadmium-induced apoptosis of human renal proximal tubular cells.
More...