Property Summary

Ligand Count 7
NCBI Gene PubMed Count 340
PubMed Score 74.34
PubTator Score 379.50

Knowledge Summary

Patent (2,819)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.200 9.3e-03
Breast cancer -1.300 3.3e-07
ependymoma 1.800 3.8e-03
glioblastoma 1.100 1.1e-03
intraductal papillary-mucinous adenoma (... 1.200 3.2e-02
intraductal papillary-mucinous neoplasm ... 1.100 1.2e-02
juvenile dermatomyositis 1.120 2.2e-08
oligodendroglioma 1.200 1.3e-02
osteosarcoma -1.622 6.8e-05
ovarian cancer 1.200 1.4e-02

Protein-protein Interaction (3)

Gene RIF (295)

AA Sequence

MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVG      1 - 70
KIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDY     71 - 140
CHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWS    141 - 210
SGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFK    211 - 280
QDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKD    281 - 350
FYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI    351 - 420
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTAT    421 - 490
PQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ     491 - 559
//

Text Mined References (369)

PMID Year Title