Property Summary

NCBI Gene PubMed Count 275
Grant Count 19
R01 Count 15
Funding $2,628,877.86
PubMed Score 66.34
PubTator Score 379.50

Knowledge Summary

Patent (2,819)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma 1.200 0.009
ependymoma 1.800 0.004
oligodendroglioma 1.200 0.013
osteosarcoma -2.476 0.000
glioblastoma 1.100 0.001
juvenile dermatomyositis 1.120 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.032
intraductal papillary-mucinous neoplasm ... 1.900 0.011
Breast cancer -1.300 0.000
ovarian cancer 1.200 0.014

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (232)

PMID Text
26999735 Data indicate that long non-coding RNAs (lncRNAs) NBR2 (neighbour of BRCA1 gene 2) interacts with AMP-activated kinase (AMPK) and promotes AMPK kinase activity during energy stress.
26772531 AMPK actions extend well beyond its energy-regulating role, and it appears to possess an essential role in regulating fibrosis of the myocardium. (Review)
26755628 Brucella abortus infection induces AMPK activation in HeLa cells and this activation is dependent on the RNase activity of inositol-requiring enzyme 1 (IRE1).
26707164 binding between AMPK and b-catenin occurs in the cytosolic fraction, and therefore concluded that the cancer cell antiproliferative effects of selenium are mediated by a GSK3b-independent AMPK/b-catenin pathway
26655341 Data show that voltage-dependent anion channel 1 (VDAC1) knockout cells are resistant to AMP-activated protein kinase (AMPK) and mechanistic target of rapamycin (mTOR) modulation by itraconazole, indicating VDAC1 is the mediator of the activity.
26648451 when treated with exendin-4 plus AICAR, an AMPK activator, cell apoptosis increased with higher ratio of phosphorylayed-AMPK/AMPK, lower ratio of phosphorylated-mTOR/mTOR and higher expression of cleaved caspase-3 than those in exendin-4 alone group
26644014 The protective effect of ampelopsin against hyperglycemia-induced cell damage, which functions by targeting autophagy via AMPK activation, makes it a promising pharmacological treatment for type-2 diabetes.
26642043 Defective Expression of GTPBP3 triggers AMPK signal transduction, involving Complex I assembly factors.
26616021 PIAS4 activity are required for the AMPKalpha1 SUMOylation and the inhibition of AMPKalpha1 activity towards mTORC1 signalling.
26549816 our findings suggest that EEKS inhibits the growth of HepG2 cells by inducing AMPK-mediated caspase-dependent apoptosis, suggesting the potential therapeutic application of EEKS in the treatment or prevention of cancers.
More...

AA Sequence

MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVG      1 - 70
KIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDY     71 - 140
CHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWS    141 - 210
SGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFK    211 - 280
QDLPKYLFPEDPSYSSTMIDDEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKD    281 - 350
FYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI    351 - 420
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTAT    421 - 490
PQRSGSVSNYRSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMCANLIKILAQ     491 - 559
//

Text Mined References (304)

PMID Year Title
26999735 2016 LncRNA NBR2 engages a metabolic checkpoint by regulating AMPK under energy stress.
26772531 2016 AMPK in cardiac fibrosis and repair: Actions beyond metabolic regulation.
26755628 2016 Inositol-Requiring Enzyme 1-Dependent Activation of AMPK Promotes Brucella abortus Intracellular Growth.
26707164 2016 AMPK interacts with ?-catenin in the regulation of hepatocellular carcinoma cell proliferation and survival with selenium treatment.
26655341 2015 Antifungal drug itraconazole targets VDAC1 to modulate the AMPK/mTOR signaling axis in endothelial cells.
26648451 2016 Exenatide inhibits the growth of endometrial cancer Ishikawa xenografts in nude mice.
26644014 Ampelopsin protects endothelial cells from hyperglycemia-induced oxidative damage by inducing autophagy via the AMPK signaling pathway.
26642043 2015 Defective Expression of the Mitochondrial-tRNA Modifying Enzyme GTPBP3 Triggers AMPK-Mediated Adaptive Responses Involving Complex I Assembly Factors, Uncoupling Protein 2, and the Mitochondrial Pyruvate Carrier.
26616021 2015 SUMOylation of AMPK?1 by PIAS4 specifically regulates mTORC1 signalling.
26549816 2016 Ethanol extract of Kalopanax septemlobus leaf induces caspase-dependent apoptosis associated with activation of AMPK in human hepatocellular carcinoma cells.
More...