Property Summary

NCBI Gene PubMed Count 155
PubMed Score 245.23
PubTator Score 291.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
lung cancer 1.800 1.1e-03
adult high grade glioma 1.400 2.4e-03
Astrocytoma, Pilocytic 1.700 3.9e-07
atypical teratoid / rhabdoid tumor 2.200 1.5e-08
Breast cancer 3.700 2.4e-02
cutaneous lupus erythematosus -1.200 1.2e-02
ependymoma 1.900 5.2e-11
glioblastoma 1.800 1.8e-08
intraductal papillary-mucinous neoplasm ... 1.200 4.0e-02
lung carcinoma -2.000 3.0e-31
medulloblastoma, large-cell 1.100 6.2e-04
ovarian cancer 1.500 5.5e-09
primitive neuroectodermal tumor 1.700 1.4e-05

Gene RIF (129)

AA Sequence

MATQVMGQSSGGGGLFTSSGNIGMALPNDMYDLHDLSKAELAAPQLIMLANVALTGEVNGSCCDYLVGEE      1 - 70
RQMAELMPVGDNNFSDSEEGEGLEESADIKGEPHGLENMELRSLELSVVEPQPVFEASGAPDIYSSNKDL     71 - 140
PPETPGAEDKGKSSKTKPFRCKPCQYEAESEEQFVHHIRVHSAKKFFVEESAEKQAKARESGSSTAEEGD    141 - 210
FSKGPIRCDRCGYNTNRYDHYTAHLKHHTRAGDNERVYKCIICTYTTVSEYHWRKHLRNHFPRKVYTCGK    211 - 280
CNYFSDRKNNYVQHVRTHTGERPYKCELCPYSSSQKTHLTRHMRTHSGEKPFKCDQCSYVASNQHEVTRH    281 - 350
ARQVHNGPKPLNCPHCDYKTADRSNFKKHVELHVNPRQFNCPVCDYAASKKCNLQYHFKSKHPTCPNKTM    351 - 420
DVSKVKLKKTKKREADLPDNITNEKTEIEQTKIKGDVAGKKNEKSVKAEKRDVSKEKKPSNNVSVIQVTT    421 - 490
RTRKSVTEVKEMDVHTGSNSEKFSKTKKSKRKLEVDSHSLHGPVNDEESSTKKKKKVESKSKNNSQEVPK    491 - 560
GDSKVEENKKQNTCMKKSTKKKTLKNKSSKKSSKPPQKEPVEKGSAQMDPPQMGPAPTEAVQKGPVQVEP    561 - 630
PPPMEHAQMEGAQIRPAPDEPVQMEVVQEGPAQKELLPPVEPAQMVGAQIVLAHMELPPPMETAQTEVAQ    631 - 700
MGPAPMEPAQMEVAQVESAPMQVVQKEPVQMELSPPMEVVQKEPVQIELSPPMEVVQKEPVKIELSPPIE    701 - 770
VVQKEPVQMELSPPMGVVQKEPAQREPPPPREPPLHMEPISKKPPLRKDKKEKSNMQSERARKEQVLIEV    771 - 840
GLVPVKDSWLLKESVSTEDLSPPSPPLPKENLREEASGDQKLLNTGEGNKEAPLQKVGAEEADESLPGLA    841 - 910
ANINESTHISSSGQNLNTPEGETLNGKHQTDSIVCEMKMDTDQNTRENLTGINSTVEEPVSPMLPPSAVE    911 - 980
EREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSDNMSEGSDDSGLHGARPVPQESSRKNAKEA    981 - 1050
LAVKAAKGDFVCIFCDRSFRKGKDYSKHLNRHLVNVYYLEEAAQGQE                          1051 - 1097
//

Text Mined References (159)

PMID Year Title