Property Summary

NCBI Gene PubMed Count 149
Grant Count 111
R01 Count 86
Funding $19,150,581.98
PubMed Score 228.35
PubTator Score 291.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13127 A2RUE0 B9EGJ0 Q12956 Q12957 Q13134 Q59ER1 Q8IWI3
Symbols WT6
XBR
NRSF

Gene

PDB

2CZY  

Gene RIF (123)

PMID Text
26708060 A role was determined for the NRSF-BDNF pathway in the modulation of cognitive function in patients with newly diagnosed epilepsy.
26690059 a new role for REST in regulation of growth and early differentiation decisions in human embryonic stem cells.
26647819 REST represses transcription of HIF-1alpha in prolonged hypoxia, thus contributing to the resolution of the HIF-1alpha response.
26551668 Mutations in the transcriptional repressor REST predispose to Wilms tumor.
26341630 Results demonstrate that REST regulates AF1q gene transcription through direct binding at -383 to -363 bp of AF1q promoter.
26307266 Resveratrol via SIRT1/c-Jun downregulates REST mRNA and protein in SH-SY5Y cells.
26119235 Cultured astrocytes gradually became refractory to reprogramming, in part by the repressor REST preventing Neurog2 from binding to the NeuroD4 promoter.
26100015 loss of REST induces a pathogenic program that works through the type 1 insulin-like growth factor receptor/insulin receptor substrate 1 pathway.
26071481 The splicing of REST by SRRM4 could promote the neuroendocrine phenotype in CRPC.
26003726 pioglitazone can inhibit proliferation and induce apoptosis of glioma cell in vitro, which may be mediated by down-regulating REST mRNA level but not by inducing alternative splicing of REST pre-mRNA
More...

AA Sequence

MATQVMGQSSGGGGLFTSSGNIGMALPNDMYDLHDLSKAELAAPQLIMLANVALTGEVNGSCCDYLVGEE      1 - 70
RQMAELMPVGDNNFSDSEEGEGLEESADIKGEPHGLENMELRSLELSVVEPQPVFEASGAPDIYSSNKDL     71 - 140
PPETPGAEDKGKSSKTKPFRCKPCQYEAESEEQFVHHIRVHSAKKFFVEESAEKQAKARESGSSTAEEGD    141 - 210
FSKGPIRCDRCGYNTNRYDHYTAHLKHHTRAGDNERVYKCIICTYTTVSEYHWRKHLRNHFPRKVYTCGK    211 - 280
CNYFSDRKNNYVQHVRTHTGERPYKCELCPYSSSQKTHLTRHMRTHSGEKPFKCDQCSYVASNQHEVTRH    281 - 350
ARQVHNGPKPLNCPHCDYKTADRSNFKKHVELHVNPRQFNCPVCDYAASKKCNLQYHFKSKHPTCPNKTM    351 - 420
DVSKVKLKKTKKREADLPDNITNEKTEIEQTKIKGDVAGKKNEKSVKAEKRDVSKEKKPSNNVSVIQVTT    421 - 490
RTRKSVTEVKEMDVHTGSNSEKFSKTKKSKRKLEVDSHSLHGPVNDEESSTKKKKKVESKSKNNSQEVPK    491 - 560
GDSKVEENKKQNTCMKKSTKKKTLKNKSSKKSSKPPQKEPVEKGSAQMDPPQMGPAPTEAVQKGPVQVEP    561 - 630
PPPMEHAQMEGAQIRPAPDEPVQMEVVQEGPAQKELLPPVEPAQMVGAQIVLAHMELPPPMETAQTEVAQ    631 - 700
MGPAPMEPAQMEVAQVESAPMQVVQKEPVQMELSPPMEVVQKEPVQIELSPPMEVVQKEPVKIELSPPIE    701 - 770
VVQKEPVQMELSPPMGVVQKEPAQREPPPPREPPLHMEPISKKPPLRKDKKEKSNMQSERARKEQVLIEV    771 - 840
GLVPVKDSWLLKESVSTEDLSPPSPPLPKENLREEASGDQKLLNTGEGNKEAPLQKVGAEEADESLPGLA    841 - 910
ANINESTHISSSGQNLNTPEGETLNGKHQTDSIVCEMKMDTDQNTRENLTGINSTVEEPVSPMLPPSAVE    911 - 980
EREAVSKTALASPPATMAANESQEIDEDEGIHSHEGSDLSDNMSEGSDDSGLHGARPVPQESSRKNAKEA    981 - 1050
LAVKAAKGDFVCIFCDRSFRKGKDYSKHLNRHLVNVYYLEEAAQGQE                          1051 - 1097
//

Text Mined References (153)

PMID Year Title
26708060 2016 NRSF and BDNF polymorphisms as biomarkers of cognitive dysfunction in adults with newly diagnosed epilepsy.
26690059 2015 REST/NRSF Knockdown Alters Survival, Lineage Differentiation and Signaling in Human Embryonic Stem Cells.
26647819 2015 REST mediates resolution of HIF-dependent gene expression in prolonged hypoxia.
26551668 2015 Mutations in the transcriptional repressor REST predispose to Wilms tumor.
26341630 2015 RE1 silencing transcription factor (REST) negatively regulates ALL1-fused from chromosome 1q (AF1q) gene transcription.
26307266 2015 Resveratrol via sirtuin-1 downregulates RE1-silencing transcription factor (REST) expression preventing PCB-95-induced neuronal cell death.
26119235 2015 Transcriptional Mechanisms of Proneural Factors and REST in Regulating Neuronal Reprogramming of Astrocytes.
26100015 2015 Type 1 Insulin-Like Growth Factor Receptor/Insulin Receptor Substrate 1 Signaling Confers Pathogenic Activity on Breast Tumor Cells Lacking REST.
26071481 2015 SRRM4 Expression and the Loss of REST Activity May Promote the Emergence of the Neuroendocrine Phenotype in Castration-Resistant Prostate Cancer.
26003726 2015 Expression of REST4 in human gliomas in vivo and influence of pioglitazone on REST in vitro.
More...