Property Summary

NCBI Gene PubMed Count 63
Grant Count 65
R01 Count 40
Funding $8,281,721.77
PubMed Score 180.33
PubTator Score 187.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -1.100 0.002
sonic hedgehog group medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.600 0.002
primitive neuroectodermal tumor 1.100 0.000
adrenocortical carcinoma -1.094 0.000
lung carcinoma -1.100 0.000
ovarian cancer 1.100 0.000

Synonym

Accession Q13126 I2G7M5 I2G7M6 I2G7M7 I2G7M8 I2G7M9 I2G7N0 Q5T3P3 Q9H010
Symbols BDMF
MSAP
DMSFH
LGMBF
DMSMFH
c86fus
HEL-249

Gene

PANTHER Protein Class (2)

PDB

3LN5   1CB0   1CG6   1K27   1SD1   1SD2   3OZC   3OZD   3OZE  

 GWAS Trait (1)

Gene RIF (48)

PMID Text
26751376 MTAP expression was significantly higher in Luminal-A breast tumors than in triple negative breast neoplasms, suggesting the lack of expression in more aggressive breast tumors.
26656376 MTAP deficiency was predictive of worse disease-specific survival and distant metastasis-free survival, suggesting its role in disease progression and as an independent prognostic biomarker of nasopharyngeal carcinoma
26088413 study to describe MTAP expression in a series of Pilocytic astrocytomas and relate it to the clinicopathological features of the patients; found MTAP expression is retained in Pilocytic astrocytomas and is not an outcome predictor for these tumors
25426549 In the MTAP-deficient cases, the homozygous deletion of MTAP predicted adverse outcome. In MTAP-deficient cells, MTAP reexpression inhibited cell migration and invasion, proliferation and anchorage-independent colony formation and downregulated cyclin D1.
24969958 MTAP expression is an independent prognostic factor and has greater prognostic significance than p16 expression in non-small cell lung cancer and concordant loss of MTAP and p16 expression indicates poor outcomes in lung cancer patients.
24324622 MTAP-mediated regulation of methylthioadenosine links polyamine metabolism with NF-kappaB activation and apoptosis in hepatic stellate cells.
23508829 Homozygous deletion of MTAP gene is associated with haploid lymphoblastic leukemia.
23462334 SNP rs10118757 was associated with CAD risk in a Chinese Han population, indicating that MTAP gene may play a potential role in the pathophysiological process of CAD.
23040436 Authors report here that a high percentage of t-cell lymphoma lack the enzyme methylthioadenosine phosphorylase (MTAP).
23000879 Letter: inactivation of MTAP expression seems to be an important step in the development and progression of malignant melanoma. of
More...

AA Sequence

MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCVLLARHGRQHTIMPS      1 - 70
KVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDRTTMRPQSFYDGSHSCARGVCHIPM     71 - 140
AEPFCPKTREVLIETAKKLGLRCHSKGTMVTIEGPRFSSRAESFMFRTWGADVINMTTVPEVVLAKEAGI    141 - 210
CYASIAMATDYDCWKEHEEAVSVDRVLKTLKENANKAKSLLLTTIPQIGSTEWSETLHNLKNMAQFSVLL    211 - 280
PRH                                                                       281 - 283
//

Text Mined References (72)

PMID Year Title
26751376 2016 Characterization of MTAP Gene Expression in Breast Cancer Patients and Cell Lines.
26656376 2015 Characterization and Prognostic Significance of Methylthioadenosine Phosphorylase Deficiency in Nasopharyngeal Carcinoma.
26088413 2015 Expression of Methylthioadenosine Phosphorylase (MTAP) in Pilocytic Astrocytomas.
25426549 2014 Downregulated MTAP expression in myxofibrosarcoma: A characterization of inactivating mechanisms, tumor suppressive function, and therapeutic relevance.
25416956 2014 A proteome-scale map of the human interactome network.
24969958 2014 MTAP is an independent prognosis marker and the concordant loss of MTAP and p16 expression predicts short survival in non-small cell lung cancer patients.
24324622 2013 Expression and function of methylthioadenosine phosphorylase in chronic liver disease.
23508829 2013 Next-generation-sequencing-based risk stratification and identification of new genes involved in structural and sequence variations in near haploid lymphoblastic leukemia.
23462334 2013 Association between rs10118757(A/G) in methylthioadenosine phosphorylase gene and coronary artery disease in Chinese Hans.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
More...