Property Summary

NCBI Gene PubMed Count 22
Grant Count 14
R01 Count 6
Funding $2,848,645.23
PubMed Score 96.85
PubTator Score 73.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
uncontrolled asthma -1.200 0.043
osteosarcoma -1.833 0.000
diabetes mellitus 1.900 0.001
posterior fossa group B ependymoma 1.200 0.000
ovarian cancer -1.400 0.000
chronic rhinosinusitis -1.318 0.014
dermatomyositis 1.100 0.001

Gene RIF (10)

PMID Text
25277267 Data suggest an indirect radiosensitivity of hIK channels to low-dose photon irradiation with an impact on cell differentiation.
24996188 IK is an essential protein for achieving correct mitotic progress through the regulation of mitotic kinases and phosphatases
24945353 Data suggest that two human spliceosomal factors, RED and SMU1, are recruited to control expression and alternative splicing of viral exportins via PB2 (polymerase PB2) of influenza A virus (H3N2) and are required for efficient viral multiplication.
22351768 RED is required for kinetochore localization of MAD1, mitotic progression, and activation of the spindle assembly checkpoint.
22190034 HIV-1 Rev is identified to have a physical interaction with IK cytokine, down-regulator of HLA II (IK; RED) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21509594 IK gene expression is decreased in follicular variant of papillary thyroid carcinoma.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19845895 Observational study of gene-disease association. (HuGE Navigator)
19064678 At least three genes, orthologous to loci in this LD block, HBEGF, IK, and SRA1, result independently in a phenotype of myocardial contractile dysfunction when their expression is reduced with morpholino antisense reagents.

AA Sequence

MPERDSEPFSNPLAPDGHDVDDPHSFHQSKLTNEDFRKLLMTPRAAPTSAPPSKSRHHEMPREYNEDEDP      1 - 70
AARRRKKKSYYAKLRQQEIERERELAEKYRDRAKERRDGVNKDYEETELISTTANYRAVGPTAEADKSAA     71 - 140
EKRRQLIQESKFLGGDMEHTHLVKGLDFALLQKVRAEIASKEKEEEELMEKPQKETKKDEDPENKIEFKT    141 - 210
RLGRNVYRMLFKSKAYERNELFLPGRMAYVVDLDDEYADTDIPTTLIRSKADCPTMEAQTTLTTNDIVIS    211 - 280
KLTQILSYLRQGTRNKKLKKKDKGKLEEKKPPEADMNIFEDIGDYVPSTTKTPRDKERERYRERERDRER    281 - 350
DRDRDRERERERDRERERERDREREEEKKRHSYFEKPKVDDEPMDVDKGPGSTKELIKSINEKFAGSAGW    351 - 420
EGTESLKKPEDKKQLGDFFGMSNSYAECYPATMDDMAVDSDEEVDYSKMDQGNKKGPLGRWDFDTQEEYS    421 - 490
EYMNNKEALPKAAFQYGIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKKMEADGVEVKRPKY       491 - 557
//

Text Mined References (32)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25277267 2015 Low-dose photon irradiation alters cell differentiation via activation of hIK channels.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24996188 2014 Depletion of IK causes mitotic arrest through aberrant regulation of mitotic kinases and phosphatases.
24945353 2014 Recruitment of RED-SMU1 complex by Influenza A Virus RNA polymerase to control Viral mRNA splicing.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22351768 2012 RED, a spindle pole-associated protein, is required for kinetochore localization of MAD1, mitotic progression, and activation of the spindle assembly checkpoint.
22190034 2011 Global landscape of HIV-human protein complexes.
More...