Property Summary

NCBI Gene PubMed Count 24
PubMed Score 100.51
PubTator Score 73.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
chronic rhinosinusitis -1.318 1.4e-02
dermatomyositis 1.100 7.2e-04
diabetes mellitus 1.800 1.5e-03
osteosarcoma -1.833 1.0e-07
ovarian cancer -1.400 5.0e-05
posterior fossa group B ependymoma 1.200 1.7e-06
uncontrolled asthma -1.200 4.3e-02

Gene RIF (11)

AA Sequence

MPERDSEPFSNPLAPDGHDVDDPHSFHQSKLTNEDFRKLLMTPRAAPTSAPPSKSRHHEMPREYNEDEDP      1 - 70
AARRRKKKSYYAKLRQQEIERERELAEKYRDRAKERRDGVNKDYEETELISTTANYRAVGPTAEADKSAA     71 - 140
EKRRQLIQESKFLGGDMEHTHLVKGLDFALLQKVRAEIASKEKEEEELMEKPQKETKKDEDPENKIEFKT    141 - 210
RLGRNVYRMLFKSKAYERNELFLPGRMAYVVDLDDEYADTDIPTTLIRSKADCPTMEAQTTLTTNDIVIS    211 - 280
KLTQILSYLRQGTRNKKLKKKDKGKLEEKKPPEADMNIFEDIGDYVPSTTKTPRDKERERYRERERDRER    281 - 350
DRDRDRERERERDRERERERDREREEEKKRHSYFEKPKVDDEPMDVDKGPGSTKELIKSINEKFAGSAGW    351 - 420
EGTESLKKPEDKKQLGDFFGMSNSYAECYPATMDDMAVDSDEEVDYSKMDQGNKKGPLGRWDFDTQEEYS    421 - 490
EYMNNKEALPKAAFQYGIKMSEGRKTRRFKETNDKAELDRQWKKISAIIEKRKKMEADGVEVKRPKY       491 - 557
//

Text Mined References (35)

PMID Year Title