Property Summary

NCBI Gene PubMed Count 63
Grant Count 55
R01 Count 39
Funding $4,153,837.33
PubMed Score 82.95
PubTator Score 63.09

Knowledge Summary

Patent

No data available

Expression

 GO Component (1)

Gene RIF (35)

PMID Text
26922828 TIEG-1 overexpression in normal human skin fibroblasts results in improved resistance to oxidative stress
26119394 photoexposure decreases expression in fibroblasts and keratinocytes
25728284 CDK2 up-regulates the protein level of KLF10 through reducing its association with SIAH1, a KLF10 E3-ubiqutin ligase involved in proteasomal degradation.
25613138 The gene expression of Krueppel-like factor 10 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25472963 KLF10 directly binds to TGF-BRII promoter in T cells, leading to enhanced gene expression.
24944246 KLF10, functions as a toggle to integrate antagonistic signals regulating FOXP3 via Sin3-HDAC/PCAF pathway and, thus, immune activation.
24885297 The tumor suppressor function of LSAMP is most likely exerted by reducing the proliferation rate of the tumor cells, possibly by indirectly upregulating one or more of the genes HES1, CTAG2 or KLF10.
24162774 The gene expression of Krueppel-like factor 10 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
23994618 RAF-1 phosphorylation and PIN1 isomerization together regulate KLF10 stability and further affect the role of KLF10 in tumor progression.
23569208 KLF10 is an effective repressor of myoblast proliferation and represses FGFR1 promoter activity in these cells via an Sp1 binding site.
More...

AA Sequence

MLNFGASLQQTAEERMEMISERPKESMYSWNKTAEKSDFEAVEALMSMSCSWKSDFKKYVENRPVTPVSD      1 - 70
LSEEENLLPGTPDFHTIPAFCLTPPYSPSDFEPSQVSNLMAPAPSTVHFKSLSDTAKPHIAAPFKEEEKS     71 - 140
PVSAPKLPKAQATSVIRHTADAQLCNHQTCPMKAASILNYQNNSFRRRTHLNVEAARKNIPCAAVSPNRS    141 - 210
KCERNTVADVDEKASAALYDFSVPSSETVICRSQPAPVSPQQKSVLVSPPAVSAGGVPPMPVICQMVPLP    211 - 280
ANNPVVTTVVPSTPPSQPPAVCPPVVFMGTQVPKGAVMFVVPQPVVQSSKPPVVSPNGTRLSPIAPAPGF    281 - 350
SPSAAKVTPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARSDELSRHR    351 - 420
RTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALPPTPAPTQ              421 - 480
//

Text Mined References (67)

PMID Year Title
26922828 2016 TGF-beta-induced early gene-1 overexpression promotes oxidative stress protection and actin cytoskeleton rearrangement in human skin fibroblasts.
26119394 2015 Impact of exogenous stress on TGF-? inducible early gene 1 in human skin cells.
25728284 2015 CDK2 phosphorylation regulates the protein stability of KLF10 by interfering with binding of the E3 ligase SIAH1.
25472963 2015 Krüppel-like factor KLF10 regulates transforming growth factor receptor II expression and TGF-? signaling in CD8+ T lymphocytes.
24944246 2014 Differential coupling of KLF10 to Sin3-HDAC and PCAF regulates the inducibility of the FOXP3 gene.
24885297 2014 Reexpression of LSAMP inhibits tumor growth in a preclinical osteosarcoma model.
23994618 2013 Destabilization of KLF10, a tumor suppressor, relies on thr93 phosphorylation and isomerase association.
23770605 2013 Genome-wide association study identifies multiple risk loci for chronic lymphocytic leukemia.
23569208 2013 Repression of myoblast proliferation and fibroblast growth factor receptor 1 promoter activity by KLF10 protein.
23232713 2013 Cistanches Herba aqueous extract affecting serum BGP and TRAP and bone marrow Smad1 mRNA, Smad5 mRNA, TGF-?1 mRNA and TIEG1 mRNA expression levels in osteoporosis disease.
More...