Property Summary

NCBI Gene PubMed Count 33
PubMed Score 1.49
PubTator Score 13.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Azoospermia 89 4.551 2.3
Y chromosome deletions 7

Gene RIF (10)

PMID Text
26232607 Studies indicate that partial RNA-binding proteins DAZ1/2 deletion was associated wih male infertility, but partial RNA-binding proteins DAZ3/4 deletion was not associated with male infertility.
24878370 Deletion of DAZ2 and DAZ4 gene copies is associated with male infertility.
23512232 There appears to be an asociation of DAZ1/DAZ2 deletion with spermatogenic impairment and male infertility in the South Chinese population.
19223287 All four DAZ genes are expressed in the human testis, and their products are highly polymorphic among men
17416365 AZFc subdeletions do not seem to cause severe impairment of spermatogenesis in Chilean men.
16963411 Observational study of gene-disease association. (HuGE Navigator)
16674553 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
16580401 Observational study of gene-disease association. (HuGE Navigator)
16491269 Observational study of genotype prevalence. (HuGE Navigator)
11883873 DAZ gene copy number in severely idiopathic infertile men. Gene deletion of two copies of DAZ (DAZI and 2) was the cause of spermatogenic damage.

AA Sequence

MSAANPETPNSTISREASTQSSSAAASQGWVLPEGKIVPNTVFVGGIDARMDETEIGSCFGRYGSVKEVK      1 - 70
IITNRTGVSKGYGFVSFVNDVDVQKIVGSQIHFHGKKLKLGPAIRKQKLCARHVQPRPLVVNPPPPPQFQ     71 - 140
NVWRNPNTETYLQPQITPNPVTQHVQAYSAYPHSPGQVITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPV    141 - 210
YNYQPFPAYPRSPFQVTAGYQLPVYNYQAFPAYPNSPFQVATGYQFPVYNYQPFPAYPSSPFQVTAGYQL    211 - 280
PVYNYQAFPAYPNSPFQVATGYQFPVYNYQAFPAYPNSPVQVTTGYQLPVYNYQAFPAYPNSPVQVTTGY    281 - 350
QLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQVTT    351 - 420
GYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQVTTGYQLPVYNYQAFPAYPSSPFQV    421 - 490
TTGYQLPVYNYQAFPAYPNSAVQVTTGYQFHVYNYQMPPQCPVGEQRRNLWTEAYKWWYLVCLIQRRD      491 - 558
//

Text Mined References (34)

PMID Year Title
26232607 2015 Impact of partial DAZ1/2 deletion and partial DAZ3/4 deletion on male infertility.
24878370 2014 Combined deletion of DAZ2 and DAZ4 copies of Y chromosome DAZ gene is associated with male infertility in Tunisian men.
23512232 2013 Association of DAZ1/DAZ2 deletion with spermatogenic impairment and male infertility in the South Chinese population.
19223287 2009 Polymorphic expression of DAZ proteins in the human testis.
17416365 2007 AZFc partial deletions in Chilean men with severe spermatogenic failure.
16963411 2006 [Study on DAZ gene copy deletion in severe oligozoospermia sperm donor for ICSI].
16674553 2006 A frequent partial AZFc deletion does not render an increased risk of spermatogenic impairment in East Asians.
16580401 2006 Preliminary study of the relationship between DAZ gene copy deletions and spermatogenic impairment in Chinese men.
16491269 2006 DAZ1/DAZ2 cluster deletion mediated by gr/gr recombination per se may not be sufficient for spermatogenesis impairment: a study of Chinese normozoospermic men.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...