Property Summary

NCBI Gene PubMed Count 42
PubMed Score 227.53
PubTator Score 60.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Juvenile arthritis 124
Disease Target Count P-value
cystic fibrosis 1670 7.55501011216165E-8
tuberculosis 1563 8.17298985468284E-8
malignant mesothelioma 3163 1.66122836189439E-7
acute quadriplegic myopathy 1157 2.00641478499049E-6
posterior fossa group B ependymoma 1530 3.39161101345141E-6
lung cancer 4473 2.88579804168737E-5
group 3 medulloblastoma 2254 0.00217015120989818
interstitial cystitis 2299 0.00280890770646112
atypical teratoid / rhabdoid tumor 4369 0.00353297068024448
pituitary cancer 1972 0.0040172228004649
osteosarcoma 7933 0.00564484114261793
active ulcerative colitis 477 0.0118248087153104
invasive ductal carcinoma 2950 0.0126335969001638
psoriasis 6685 0.0144796739254124
Breast cancer 3099 0.0150277794027061
glioblastoma 5572 0.0155910470122335
pediatric high grade glioma 2712 0.0168326703761926
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0208953175126609
facioscapulohumeral dystrophy 286 0.0231840740206245
active Crohn's disease 918 0.0311919251653639
colon cancer 1475 0.032521657518399
Barrett's esophagus 185 0.0388032695315448
adrenocortical adenoma 134 0.0416364660308951
esophageal adenocarcinoma 737 0.0425590178618612
Disease Target Count Z-score Confidence
Autistic Disorder 320 3.949 2.0
Echolalia 5 3.391 1.7
Cancer 2346 3.101 1.6

Expression

  Differential Expression (24)

Synonym

Accession Q13115 B2RBU5 D3DSU4 G5E930 Q13524
Symbols TYP
HVH2
MKP2
MKP-2

Gene

PDB

3EZZ  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

Gene RIF (29)

PMID Text
25943894 Primary human Muller glia cells treated with HIV-1 clade B Tat, but not with clade C Tat, upregulate the expression of MKP-2 protein
25847947 Ectopic expression of wild-type DUSP4, but not of a phosphatase-deficient mutant, dephosphorylates c-JUN N-terminal kinase (JNK) and induces apoptosis in DLBCL cells.
25733583 Data indicate that normalization of dual-specific phosphatase 4 (DUSP4) expression using a specific siRNA improved CD4(+) T-cell activity in idiopathic CD4 lymphopenia (ICL).
25281216 Low DUSP4 expression levels predict recurrence and mortality in triple-negative breast cancer patients
25204653 MKP-1 and MKP-2 stability is regulated by ERK-mediated phosphorylation through a degradation pathway independent of polyubiquitination
25027955 Instead, autophagic cell death was the major consequence, and our investigation of mechanisms suggested it is mediated via the dual specificity phosphatase-4 (DUSP4) dependent ERK inactivation pathway
24658355 Data suggest that MKP-2 rather than MKP-1 is tamoxifen-regulated and that the elevated expression of MKP-2 in MCF7-TAMR cells potentially functions to restore tamoxifen sensitivity.
24308939 DUSP1, DUSP4, and DUSP5 differentially modulate endothelial MAPK signaling pathways downstream of Tie-2 receptors.
24222120 Increased DUSP4 expression is associated with papillary thyroid carcinoma.
23966295 Enforced expression of DUSP4 reduced the CD44(+)/CD24(-) population in multiple BLBC cell lines in a MEK-dependent manner, limiting tumor formation of claudin-low SUM159PT cells in mice.
More...

AA Sequence

MVTMEELREMDCSVLKRLMNRDENGGGAGGSGSHGTLGLPSGGKCLLLDCRPFLAHSAGYILGSVNVRCN      1 - 70
TIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLREDSTVSLVVQALRRNAERTDI     71 - 140
CLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSATEPLDLGCSSCGTPLHDQGGPVEILPFLYLGSAYH    141 - 210
AARRDMLDALGITALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHC    211 - 280
QAGISRSATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAASPSGPL    281 - 350
RERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHSPITTSPSC                              351 - 394
//

Text Mined References (46)

PMID Year Title
25847947 2015 DUSP4 deficiency caused by promoter hypermethylation drives JNK signaling and tumor cell survival in diffuse large B cell lymphoma.
25733583 2015 DUSP4-mediated accelerated T-cell senescence in idiopathic CD4 lymphopenia.
25281216 2014 Dual specificity phosphatase 4 gene expression in association with triple-negative breast cancer outcome.
25204653 2014 Post-translational regulation of mitogen-activated protein kinase phosphatase (MKP)-1 and MKP-2 in macrophages following lipopolysaccharide stimulation: the role of the C termini of the phosphatases in determining their stability.
25027955 2014 Inhibition of G9a induces DUSP4-dependent autophagic cell death in head and neck squamous cell carcinoma.
24658355 2014 Functional analysis of MKP-1 and MKP-2 in breast cancer tamoxifen sensitivity.
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
24308939 2013 Regulation of angiopoietin-1/Tie-2 receptor signaling in endothelial cells by dual-specificity phosphatases 1, 4, and 5.
24222120 2013 DNA methylation of MAPK signal-inhibiting genes in papillary thyroid carcinoma.
23966295 2013 Activation of MAPK pathways due to DUSP4 loss promotes cancer stem cell-like phenotypes in basal-like breast cancer.
More...