Property Summary

NCBI Gene PubMed Count 42
Grant Count 63
R01 Count 43
Funding $10,001,476.68
PubMed Score 227.53
PubTator Score 60.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Synonym

Accession Q13115 B2RBU5 D3DSU4 G5E930 Q13524
Symbols TYP
HVH2
MKP2
MKP-2

Gene

PDB

3EZZ  

Gene RIF (29)

PMID Text
25943894 Primary human Muller glia cells treated with HIV-1 clade B Tat, but not with clade C Tat, upregulate the expression of MKP-2 protein
25847947 Ectopic expression of wild-type DUSP4, but not of a phosphatase-deficient mutant, dephosphorylates c-JUN N-terminal kinase (JNK) and induces apoptosis in DLBCL cells.
25733583 Data indicate that normalization of dual-specific phosphatase 4 (DUSP4) expression using a specific siRNA improved CD4(+) T-cell activity in idiopathic CD4 lymphopenia (ICL).
25281216 Low DUSP4 expression levels predict recurrence and mortality in triple-negative breast cancer patients
25204653 MKP-1 and MKP-2 stability is regulated by ERK-mediated phosphorylation through a degradation pathway independent of polyubiquitination
25027955 Instead, autophagic cell death was the major consequence, and our investigation of mechanisms suggested it is mediated via the dual specificity phosphatase-4 (DUSP4) dependent ERK inactivation pathway
24658355 Data suggest that MKP-2 rather than MKP-1 is tamoxifen-regulated and that the elevated expression of MKP-2 in MCF7-TAMR cells potentially functions to restore tamoxifen sensitivity.
24308939 DUSP1, DUSP4, and DUSP5 differentially modulate endothelial MAPK signaling pathways downstream of Tie-2 receptors.
24222120 Increased DUSP4 expression is associated with papillary thyroid carcinoma.
23966295 Enforced expression of DUSP4 reduced the CD44(+)/CD24(-) population in multiple BLBC cell lines in a MEK-dependent manner, limiting tumor formation of claudin-low SUM159PT cells in mice.
More...

AA Sequence

MVTMEELREMDCSVLKRLMNRDENGGGAGGSGSHGTLGLPSGGKCLLLDCRPFLAHSAGYILGSVNVRCN      1 - 70
TIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLREDSTVSLVVQALRRNAERTDI     71 - 140
CLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSATEPLDLGCSSCGTPLHDQGGPVEILPFLYLGSAYH    141 - 210
AARRDMLDALGITALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHC    211 - 280
QAGISRSATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLATSCAAEAASPSGPL    281 - 350
RERGKTPATPTSQFVFSFPVSVGVHSAPSSLPYLHSPITTSPSC                              351 - 394
//

Text Mined References (46)

PMID Year Title
25847947 2015 DUSP4 deficiency caused by promoter hypermethylation drives JNK signaling and tumor cell survival in diffuse large B cell lymphoma.
25733583 2015 DUSP4-mediated accelerated T-cell senescence in idiopathic CD4 lymphopenia.
25281216 2014 Dual specificity phosphatase 4 gene expression in association with triple-negative breast cancer outcome.
25204653 2014 Post-translational regulation of mitogen-activated protein kinase phosphatase (MKP)-1 and MKP-2 in macrophages following lipopolysaccharide stimulation: the role of the C termini of the phosphatases in determining their stability.
25027955 2014 Inhibition of G9a induces DUSP4-dependent autophagic cell death in head and neck squamous cell carcinoma.
24658355 2014 Functional analysis of MKP-1 and MKP-2 in breast cancer tamoxifen sensitivity.
24531476 2014 The family-wide structure and function of human dual-specificity protein phosphatases.
24308939 2013 Regulation of angiopoietin-1/Tie-2 receptor signaling in endothelial cells by dual-specificity phosphatases 1, 4, and 5.
24222120 2013 DNA methylation of MAPK signal-inhibiting genes in papillary thyroid carcinoma.
23966295 2013 Activation of MAPK pathways due to DUSP4 loss promotes cancer stem cell-like phenotypes in basal-like breast cancer.
More...