Property Summary

NCBI Gene PubMed Count 144
Grant Count 154
R01 Count 112
Funding $12,533,600.06
PubMed Score 297.61
PubTator Score 214.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 1.100 0.001
osteosarcoma -1.203 0.000
glioblastoma -1.200 0.000
tuberculosis and treatment for 6 months -1.500 0.000
lung cancer 2.300 0.002
adult high grade glioma -1.200 0.000
sonic hedgehog group medulloblastoma -1.100 0.007
primary Sjogren syndrome 1.400 0.001
subependymal giant cell astrocytoma -1.174 0.006
gastric carcinoma 1.600 0.006
ovarian cancer -1.500 0.000

Synonym

Accession Q13114 B7Z8C4 Q12990 Q13076 Q13947 Q6AZX1 Q9UNL1
Symbols CAP1
LAP1
CAP-1
CRAF1
IIAE5
CD40bp

Gene

PANTHER Protein Class (1)

PDB

1FLL   1RF3   1KZZ   1L0A   1FLK   1ZMS   2ECY   2GKW  

Gene RIF (84)

PMID Text
26928339 Findings establish CK1varepsilon as a regulator of antiviral innate immune responses and indicate a novel mechanism of immunoregulation that involves CK1varepsilon-mediated phosphorylation of TRAF3.
26755589 TRAF3 regulates B-cell survival via inhibition of CREB stability
26519536 these findings demonstrate that WDR82 is a negative regulator of virus-triggered type I IFNs pathway through mediating TRAF3 polyubiquitination status and stability on mitochondria.
26456228 These findings suggest that RNF166 positively regulates RNA virus-triggered IFN-beta production by enhancing the ubiquitination of TRAF3 and TRAF6.
26454171 RIG-I-like receptor mediated antiviral innate immune responses in the lower respiratory tract involves TRAF3 and TRAF5 signaling.
26329582 findings identify TRAF3 and PTPN22 as inhibitors of IL-6R signaling in B cells and reveal a previously uncharacterized role for TRAF3 in the regulation of plasma cell differentiation
26186972 ESR1 directly interacts with TRAF3 and promotes K48-linked proteasomal degradation of TRAF3.
26034202 Tumor necrosis factor receptor-associated factor 3 (TRAF3) is a positive regulator of pathological cardiac hypertrophy in mice and humans.
25723057 TRAF3 regulates signaling to T cells not only through costimulatory members of the TNFR superfamily, but also through the T cell receptor complex, and cytokine receptors.
25468570 Focal genetic loss of TRAF3 is recurrent in human diffuse large B-cell lymphoma.
More...

AA Sequence

MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGH      1 - 70
RFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKND     71 - 140
CHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSV    141 - 210
QTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNE    211 - 280
SVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSM    281 - 350
KSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW    351 - 420
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF    421 - 490
KQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV    491 - 560
DTSDLPDP                                                                  561 - 568
//

Text Mined References (150)

PMID Year Title
26928339 2016 The kinase CK1? controls the antiviral immune response by phosphorylating the signaling adaptor TRAF3.
26755589 2016 Nuclear TRAF3 is a negative regulator of CREB in B cells.
26519536 2015 WDR82 Negatively Regulates Cellular Antiviral Response by Mediating TRAF3 Polyubiquitination in Multiple Cell Lines.
26456228 2015 Ring finger protein 166 potentiates RNA virus-induced interferon-? production via enhancing the ubiquitination of TRAF3 and TRAF6.
26454171 2015 Retinoic acid-inducible gene-I-like receptor (RLR)-mediated antiviral innate immune responses in the lower respiratory tract: Roles of TRAF3 and TRAF5.
26329582 2015 The adaptor protein TRAF3 inhibits interleukin-6 receptor signaling in B cells to limit plasma cell development.
26186972 2015 Estrogen receptor alpha inhibits RLR-mediated immune response via ubiquitinating TRAF3.
26034202 2015 Tumor necrosis factor receptor-associated factor 3 is a positive regulator of pathological cardiac hypertrophy.
25723057 2015 Roles of TRAF3 in T cells: many surprises.
25468570 2015 Genetic inactivation of TRAF3 in canine and human B-cell lymphoma.
More...