Property Summary

NCBI Gene PubMed Count 160
PubMed Score 309.02
PubTator Score 214.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 1.9e-04
gastric carcinoma 1.600 5.9e-03
glioblastoma -1.200 4.3e-04
lung cancer 2.300 2.1e-03
osteosarcoma -1.203 1.3e-05
ovarian cancer -1.500 2.5e-07
primary Sjogren syndrome 1.400 9.6e-04
psoriasis 1.100 1.1e-03
sonic hedgehog group medulloblastoma -1.100 6.6e-03
subependymal giant cell astrocytoma -1.174 5.8e-03
tuberculosis -1.400 9.1e-07

Protein-protein Interaction (1)

Gene RIF (97)

AA Sequence

MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGH      1 - 70
RFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKND     71 - 140
CHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSV    141 - 210
QTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNE    211 - 280
SVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSM    281 - 350
KSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW    351 - 420
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF    421 - 490
KQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV    491 - 560
DTSDLPDP                                                                  561 - 568
//

Text Mined References (166)

PMID Year Title