Property Summary

NCBI Gene PubMed Count 144
PubMed Score 297.61
PubTator Score 214.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
ovarian cancer 8492 2.49706611635003E-7
osteosarcoma 7933 1.32709443302191E-5
tuberculosis and treatment for 6 months 686 6.5610231734365E-5
adult high grade glioma 2148 1.85121271503744E-4
glioblastoma 5572 4.32137680112233E-4
primary Sjogren syndrome 789 9.61610876666443E-4
psoriasis 6685 0.0011318420668386
lung cancer 4473 0.00207556365576154
subependymal giant cell astrocytoma 2287 0.00578581996582953
gastric carcinoma 832 0.00590280772231615
sonic hedgehog group medulloblastoma 1482 0.00658419909537257
Disease Target Count Z-score Confidence
Multiple Sclerosis 498 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 4.088 2.0
Disease Target Count
Herpes simplex encephalitis 3 1

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 1.100 0.001
osteosarcoma -1.203 0.000
glioblastoma -1.200 0.000
tuberculosis and treatment for 6 months -1.500 0.000
lung cancer 2.300 0.002
adult high grade glioma -1.200 0.000
sonic hedgehog group medulloblastoma -1.100 0.007
primary Sjogren syndrome 1.400 0.001
subependymal giant cell astrocytoma -1.174 0.006
gastric carcinoma 1.600 0.006
ovarian cancer -1.500 0.000

Synonym

Accession Q13114 B7Z8C4 Q12990 Q13076 Q13947 Q6AZX1 Q9UNL1
Symbols CAP1
LAP1
CAP-1
CRAF1
IIAE5
CD40bp

Gene

PANTHER Protein Class (1)

PDB

1FLL   1RF3   1KZZ   1L0A   1FLK   1ZMS   2ECY   2GKW  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (82)

PMID Text
26928339 Findings establish CK1varepsilon as a regulator of antiviral innate immune responses and indicate a novel mechanism of immunoregulation that involves CK1varepsilon-mediated phosphorylation of TRAF3.
26755589 TRAF3 regulates B-cell survival via inhibition of CREB stability
26519536 these findings demonstrate that WDR82 is a negative regulator of virus-triggered type I IFNs pathway through mediating TRAF3 polyubiquitination status and stability on mitochondria.
26456228 These findings suggest that RNF166 positively regulates RNA virus-triggered IFN-beta production by enhancing the ubiquitination of TRAF3 and TRAF6.
26454171 RIG-I-like receptor mediated antiviral innate immune responses in the lower respiratory tract involves TRAF3 and TRAF5 signaling.
26329582 findings identify TRAF3 and PTPN22 as inhibitors of IL-6R signaling in B cells and reveal a previously uncharacterized role for TRAF3 in the regulation of plasma cell differentiation
26186972 ESR1 directly interacts with TRAF3 and promotes K48-linked proteasomal degradation of TRAF3.
26034202 Tumor necrosis factor receptor-associated factor 3 (TRAF3) is a positive regulator of pathological cardiac hypertrophy in mice and humans.
25723057 TRAF3 regulates signaling to T cells not only through costimulatory members of the TNFR superfamily, but also through the T cell receptor complex, and cytokine receptors.
25468570 Focal genetic loss of TRAF3 is recurrent in human diffuse large B-cell lymphoma.
More...

AA Sequence

MESSKKMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGH      1 - 70
RFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKND     71 - 140
CHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSV    141 - 210
QTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNE    211 - 280
SVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSM    281 - 350
KSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW    351 - 420
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPF    421 - 490
KQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMNIASGCPVFVAQTVLENGTYIKDDTIFIKVIV    491 - 560
DTSDLPDP                                                                  561 - 568
//

Text Mined References (150)

PMID Year Title
26928339 2016 The kinase CK1? controls the antiviral immune response by phosphorylating the signaling adaptor TRAF3.
26755589 2016 Nuclear TRAF3 is a negative regulator of CREB in B cells.
26519536 2015 WDR82 Negatively Regulates Cellular Antiviral Response by Mediating TRAF3 Polyubiquitination in Multiple Cell Lines.
26456228 2015 Ring finger protein 166 potentiates RNA virus-induced interferon-? production via enhancing the ubiquitination of TRAF3 and TRAF6.
26454171 2015 Retinoic acid-inducible gene-I-like receptor (RLR)-mediated antiviral innate immune responses in the lower respiratory tract: Roles of TRAF3 and TRAF5.
26329582 2015 The adaptor protein TRAF3 inhibits interleukin-6 receptor signaling in B cells to limit plasma cell development.
26186972 2015 Estrogen receptor alpha inhibits RLR-mediated immune response via ubiquitinating TRAF3.
26034202 2015 Tumor necrosis factor receptor-associated factor 3 is a positive regulator of pathological cardiac hypertrophy.
25723057 2015 Roles of TRAF3 in T cells: many surprises.
25468570 2015 Genetic inactivation of TRAF3 in canine and human B-cell lymphoma.
More...