Property Summary

NCBI Gene PubMed Count 28
PubMed Score 169.26
PubTator Score 87.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease 1.575 9.5e-03
active ulcerative colitis 2.397 4.6e-03
Breast cancer -1.100 2.0e-02
chronic rhinosinusitis 1.670 2.1e-02
Endometriosis -1.121 1.9e-02
gastric cancer 1.100 2.0e-03
head and neck cancer and chronic obstruc... 1.300 3.9e-03
intraductal papillary-mucinous neoplasm ... 1.300 1.9e-02
lung adenocarcinoma 1.200 2.1e-02
nasopharyngeal carcinoma -1.200 4.4e-03
non-small cell lung cancer 1.200 3.2e-02
osteosarcoma -4.302 9.3e-05
pancreatic cancer 1.100 1.3e-02
pancreatic carcinoma 1.100 1.3e-02
psoriasis 2.600 2.1e-10

Gene RIF (14)

AA Sequence

MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPEPAHMILTVGN      1 - 70
KADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM                               71 - 114
//

Text Mined References (28)

PMID Year Title