Property Summary

NCBI Gene PubMed Count 26
Grant Count 5
R01 Count 3
Funding $475,929.5
PubMed Score 155.75
PubTator Score 87.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
gastric cancer 1.400 0.003
pancreatic cancer 1.800 0.000
psoriasis 2.600 0.000
osteosarcoma -4.302 0.000
intraductal papillary-mucinous neoplasm ... 1.300 0.019
active Crohn's disease 1.575 0.009
ulcerative colitis 3.500 0.000
pancreatic carcinoma 1.400 0.007
lung adenocarcinoma 1.200 0.021
nasopharyngeal carcinoma -1.300 0.003
Endometriosis -1.245 0.012
Breast cancer -1.100 0.020
chronic rhinosinusitis 1.670 0.021
head and neck cancer and chronic obstruc... 1.500 0.003
non-small cell lung cancer 1.200 0.032

Gene RIF (12)

PMID Text
25837675 Data show that bortezomib induces a prosurvival response through cytoprotective autophagy and nuclear factor kappa B (NFkappaB) nuclear translocation, which is repressed by high levels of membrane-associated protein 17 (MAP17).
25788275 In this study we found that the levels of MAP17 were related to clinical findings and survival in a cohort of 58 patients with larynx cancer
23418532 Results suggest that the use of MAP17 and SGLT1 markers may identify patients who are likely to exhibit a better response to treatments that boost oxidative stress in other cancer types.
22266858 MAP17 is overexpressed in late-stage breast tumors, in which oncogenic activity relies on p38 insensitivity to induce intracellular ROS.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19601982 The Th cell cytokine-induced up-regulation of MAP17 expression may be linked to the down-regulation of filaggrin in normal epidermal keratinocytes, which may be associated with abnormal epidermal differentiation observed in the dermatological diseases.
18303113 point mutation observed by transcriptome sequencing of malignant pleural mesothelioma tumors
17675338 MAP17 protein activates AKT through ROS and this is determinant to confer resistance to Myc-induced apoptosis in the absence of serum.
17548903 Tumorigenic capability of MAP17 through a connection between sodium-coupled co-transporters and reactive oxygen species.
More...

AA Sequence

MSALSLLILGLLTAVPPASCQQGLGNLQPWMQGLIAVAVFLVLVAIAFAVNHFWCQEEPEPAHMILTVGN      1 - 70
KADGVLVGTDGRYSSMAASFRSSEHENAYENVPEEEGKVRSTPM                               71 - 114
//

Text Mined References (26)

PMID Year Title
25837675 2015 MAP17 (PDZKIP1) Expression Determines Sensitivity to the Proteasomal Inhibitor Bortezomib by Preventing Cytoprotective Autophagy and NF?B Activation in Breast Cancer.
25788275 2015 MAP17 (PDZKIP1) as a novel prognostic biomarker for laryngeal cancer.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
23418532 2013 MAP17 and SGLT1 protein expression levels as prognostic markers for cervical tumor patient survival.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22266858 2012 p38? limits the contribution of MAP17 to cancer progression in breast tumors.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19601982 2010 MAP17 is associated with the T-helper cell cytokine-induced down-regulation of filaggrin transcription in human keratinocytes.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...