Property Summary

NCBI Gene PubMed Count 58
PubMed Score 40.70
PubTator Score 221.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 2.0e-05
colon cancer 1.200 8.6e-04
group 3 medulloblastoma 1.400 7.2e-04
lung cancer 1.300 1.1e-03
malignant mesothelioma 1.200 9.5e-06
medulloblastoma, large-cell 1.200 1.1e-04
non-small cell lung cancer 1.263 1.2e-15
osteosarcoma -1.587 1.7e-05
primitive neuroectodermal tumor 1.200 1.5e-02

Gene RIF (22)

AA Sequence

MLEELECGAPGARGAATAMDCKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEA      1 - 70
SLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLTEDSNEQPDSLVDHNKLNSEA     71 - 140
SPSREAINGQREDTGDQQGLLKAIQNDKLAFPGETLSDIPCKTEEEGVGCGGAGRRGDSQECSPRSCPEL    141 - 210
TSGPRMCPRKEQDSWSEAGGILFKGKVPMVVLQDILAVRPPQIKSLPATPQGKNMTPESEVLESFPEEDS    211 - 280
VLSHSSLSSPSSTSSPEGPPAPPKQHSSTSPFPTSTPLRRITKKFVKGSTEKNKLRLQRDQERLGKQLKL    281 - 350
RAEREEKEKLKEEAKRAKEEAKKKKEEEKELKEKERREKREKDEKEKAEKQRLKEERRKERQEALEAKLE    351 - 420
EKRKKEEEKRLREEEKRIKAEKAEITRFFQKPKTPQAPKTLAGSCGKFAPFEIKEHMVLAPRRRTAFHPD    421 - 490
LCSQLDQLLQQQSGEFSFLKDLKGRQPLRSGPTHVSTRNADIFNSDVVIVERGKGDGVPERRKFGRMKLL    491 - 560
QFCENHRPAYWGTWNKKTALIRARDPWAQDTKLLDYEVDSDEEWEEEEPGESLSHSEGDDDDDMGEDEDE    561 - 630
DDGFFVPHGYLSEDEGVTEECADPENHKVRQKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDD    631 - 700
LKVLQQFAACFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHT    701 - 770
GSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWS    771 - 840
YVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGFQADTEEEEEE    841 - 910
EGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTSSPLGAS                            911 - 956
//

Text Mined References (70)

PMID Year Title