Property Summary

NCBI Gene PubMed Count 52
Grant Count 89
R01 Count 79
Funding $11,990,633.66
PubMed Score 37.92
PubTator Score 221.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma -1.587 0.000
group 3 medulloblastoma 1.900 0.000
atypical teratoid/rhabdoid tumor 1.300 0.000
medulloblastoma, large-cell 1.300 0.001
primitive neuroectodermal tumor 1.200 0.015
non-small cell lung cancer 1.263 0.000
lung cancer 1.500 0.001
colon cancer 1.200 0.001

Synonym

Accession Q13111 Q6NXG5 Q7Z7K3 Q9UJY8 CAF-1 subunit A
Symbols CAF1
P150
CAF-1
CAF1B
CAF1P150

Gene

Gene RIF (19)

PMID Text
26945061 These data suggest that CAF-1- and ASF1A-H3-H4-dependent deposition of the histone (H3-H4)2 tetramers is compatible with MMR and protects the discontinuous daughter strand from unnecessary degradation by MMR machinery.
26740175 Taken together, these results show that CHAF1A contributes to the proliferation of glioblastoma cells and may be developed as a de novo drug target and prognosis biomarker of glioblastoma.
25057015 Novel functions for a separable domain of the p150 protein, regulating protein and DNA interactions at the nucleolus.
24845563 The frequency of positive CHAF1A staining in primary tumor mucosa (45.8% of 203 samples) was significantly elevated compared to normal mucosa (18.7% of samples). Increased expression was associated with cancer stage, tumor invasion and histological grade.
24335960 Histone chaperone CHAF1A inhibits differentiation and promotes aggressive neuroblastoma.
22190034 HIV-1 gp120 is identified to have a physical interaction with chromatin assembly factor 1, subunit A (CHAF1A; CAF1B) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22190034 HIV-1 gp120 is identified to have a physical interaction with chromatin assembly factor 1, subunit A (CHAF1A; CAF1B) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21445097 CAF1 was hijacked by IE2 to facilitate the replication of the HCMV genome, suggesting chromatin assembly plays an important role in herpesviral DNA synthesis, but also provide a model of the virus-induced chromatin instability through CAF1.
21282622 CAF-I-dependent control of degradation of the discontinuous strands during mismatch repair.
20800603 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLEELECGAPGARGAATAMDCKDRPAFPVKKLIQARLPFKRLNLVPKGKADDMSDDQGTSVQSKSPDLEA      1 - 70
SLDTLENNCHVGSDIDFRPKLVNGKGPLDNFLRNRIETSIGQSTVIIDLTEDSNEQPDSLVDHNKLNSEA     71 - 140
SPSREAINGQREDTGDQQGLLKAIQNDKLAFPGETLSDIPCKTEEEGVGCGGAGRRGDSQECSPRSCPEL    141 - 210
TSGPRMCPRKEQDSWSEAGGILFKGKVPMVVLQDILAVRPPQIKSLPATPQGKNMTPESEVLESFPEEDS    211 - 280
VLSHSSLSSPSSTSSPEGPPAPPKQHSSTSPFPTSTPLRRITKKFVKGSTEKNKLRLQRDQERLGKQLKL    281 - 350
RAEREEKEKLKEEAKRAKEEAKKKKEEEKELKEKERREKREKDEKEKAEKQRLKEERRKERQEALEAKLE    351 - 420
EKRKKEEEKRLREEEKRIKAEKAEITRFFQKPKTPQAPKTLAGSCGKFAPFEIKEHMVLAPRRRTAFHPD    421 - 490
LCSQLDQLLQQQSGEFSFLKDLKGRQPLRSGPTHVSTRNADIFNSDVVIVERGKGDGVPERRKFGRMKLL    491 - 560
QFCENHRPAYWGTWNKKTALIRARDPWAQDTKLLDYEVDSDEEWEEEEPGESLSHSEGDDDDDMGEDEDE    561 - 630
DDGFFVPHGYLSEDEGVTEECADPENHKVRQKLKAKEWDEFLAKGKRFRVLQPVKIGCVWAADRDCAGDD    631 - 700
LKVLQQFAACFLETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHT    701 - 770
GSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFRMCWYVHPQVLQSFQQEHLPVPCQWS    771 - 840
YVTSVPSAPKEDSGSVPSTGPSQGTPISLKRKSAGSMCITQFMKKRRHDGQIGAEDMDGFQADTEEEEEE    841 - 910
EGDCMIVDVPDAAEVQAPCGAASGAGGGVGVDTGKATLTSSPLGAS                            911 - 956
//

Text Mined References (63)

PMID Year Title
26945061 2016 DNA Mismatch Repair Interacts with CAF-1- and ASF1A-H3-H4-dependent Histone (H3-H4)2 Tetramer Deposition.
26740175 2016 Over-expression of CHAF1A promotes cell proliferation and apoptosis resistance in glioblastoma cells via AKT/FOXO3a/Bim pathway.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25057015 2014 A separable domain of the p150 subunit of human chromatin assembly factor-1 promotes protein and chromosome associations with nucleoli.
24845563 2014 Up-regulation of CHAF1A, a poor prognostic factor, facilitates cell proliferation of colon cancer.
24335960 2014 Histone chaperone CHAF1A inhibits differentiation and promotes aggressive neuroblastoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...