Property Summary

NCBI Gene PubMed Count 45
PubMed Score 118.76
PubTator Score 49.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
ovarian cancer 8520 1.1e-05
osteosarcoma 7950 3.7e-05
medulloblastoma, large-cell 6241 1.1e-03
astrocytoma 1146 9.7e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 1.6
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Multiple chemical sensitivity 6 3.104 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytoma 1.200 9.7e-03
medulloblastoma, large-cell -1.200 1.1e-03
osteosarcoma -1.072 3.7e-05
ovarian cancer -1.100 1.1e-05

Protein-protein Interaction (12)

Gene RIF (27)

AA Sequence

MAEGGGCRERPDAETQKSELGPLMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGPID      1 - 70
NSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRKVVEHGLFVKHCKVEVYLLEL     71 - 140
KLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTVQDAGLYQG    141 - 210
QVLVIEPQNEDGTWPRQTLQSKSSTAPSRNFTTSPKSSASPYSSVSASLIANGDSTSTCGMHSSGVSRGG    211 - 280
SGFSASYNCQEPPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGE    281 - 350
IAEAYAELIKQMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLEL    351 - 420
KDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRVME    421 - 490
VFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRLSGIAAENMVVADVYNHRFHKIFQMDEGLNHIMPRD    491 - 560
DIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRY    561 - 630
VKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQ    631 - 700
PCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQK    701 - 770
KKKTTVALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDT    771 - 840
VVEFPIRGLNMSEFVCNLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSNVSLASEDQI    841 - 910
VTKAAYVLFYQRRDDEFYKTPSLSSSGSSDGGTRPSSSQQGFGDDEACSMDTN                     911 - 963
//

Text Mined References (49)

PMID Year Title