Property Summary

NCBI Gene PubMed Count 39
Grant Count 6
R01 Count 4
Funding $848,815.17
PubMed Score 105.57
PubTator Score 49.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.072 0.000
astrocytoma 1.200 0.010
medulloblastoma, large-cell -1.200 0.001
ovarian cancer -1.100 0.000

Gene RIF (21)

PMID Text
26669864 Results demonstrate that aberrant expression of USP4 contributes to the development and progression of colorectal cancer and reveal a critical mechanism underlying USP4-mediated oncogenic activity.
26455393 findings thus identify USP4 as a novel DNA repair regulator and invoke a model in which ubiquitin adducts regulate USP enzyme interactions and functions.
26387952 USP4 cooperates with CtIP in DNA double-strand break end resection.
26189775 USP4 knockdown in HCT116, a colon cancer cell line, reduced invasion and migration activity.
25821221 USP4 and IL-17 mRNA, but not RORgammat mRNA, were significantly elevated in CD4(+) T cells from patients with rheumatic heart disease
25404403 USP4 requires its N-terminal DUSP-Ubl domain to achieve full catalytic turnover by promoting ubiquitin exchange.
24798342 USP4 overexpression is associated with hepatocellular carcinoma.
23388719 Authors identified USP4 as a new positive regulator for RIG-I that acts through deubiquitinating K48-linked ubiquitin chains and stabilizing RIG-I.
23313255 Data suggest that USP4 down-regulates RIP1 (receptor-interacting serine-threonine kinase 1)-mediated TNFalpha (tumor necrosis factor-alpha) activation and promotes TNFalpha-induced apoptosis via deubiquitination of RIP1 in head/neck carcinoma.
23022198 the interaction with USP4 may regulate the structure and function of the proteasome or the turnover of specific proteasomal substrates.
More...

AA Sequence

MAEGGGCRERPDAETQKSELGPLMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGPID      1 - 70
NSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRKVVEHGLFVKHCKVEVYLLEL     71 - 140
KLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTVQDAGLYQG    141 - 210
QVLVIEPQNEDGTWPRQTLQSKSSTAPSRNFTTSPKSSASPYSSVSASLIANGDSTSTCGMHSSGVSRGG    211 - 280
SGFSASYNCQEPPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGE    281 - 350
IAEAYAELIKQMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLEL    351 - 420
KDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRVME    421 - 490
VFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRLSGIAAENMVVADVYNHRFHKIFQMDEGLNHIMPRD    491 - 560
DIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRY    561 - 630
VKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQ    631 - 700
PCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQK    701 - 770
KKKTTVALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDT    771 - 840
VVEFPIRGLNMSEFVCNLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSNVSLASEDQI    841 - 910
VTKAAYVLFYQRRDDEFYKTPSLSSSGSSDGGTRPSSSQQGFGDDEACSMDTN                     911 - 963
//

Text Mined References (43)

PMID Year Title
26669864 2016 Ubiquitin-Specific Protease 4-Mediated Deubiquitination and Stabilization of PRL-3 Is Required for Potentiating Colorectal Oncogenesis.
26455393 2015 USP4 Auto-Deubiquitylation Promotes Homologous Recombination.
26387952 2015 The Deubiquitylating Enzyme USP4 Cooperates with CtIP in DNA Double-Strand Break End Resection.
26189775 2015 Ubiquitin specific protease 4 positively regulates the WNT/?-catenin signaling in colorectal cancer.
25821221 2015 Cutting edge: Ubiquitin-specific protease 4 promotes Th17 cell function under inflammation by deubiquitinating and stabilizing ROR?t.
25404403 2014 The DUSP-Ubl domain of USP4 enhances its catalytic efficiency by promoting ubiquitin exchange.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
24798342 2014 microRNA-148a dysregulation discriminates poor prognosis of hepatocellular carcinoma in association with USP4 overexpression.
23388719 2013 USP4 positively regulates RIG-I-mediated antiviral response through deubiquitination and stabilization of RIG-I.
23313255 2013 Ubiquitin-specific protease 4 promotes TNF-?-induced apoptosis by deubiquitination of RIP1 in head and neck squamous cell carcinoma.
More...