Property Summary

NCBI Gene PubMed Count 39
PubMed Score 105.57
PubTator Score 49.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
ovarian cancer 8492 1.05752951471941E-5
osteosarcoma 7933 3.69906848206292E-5
medulloblastoma, large-cell 6234 0.00108445173046868
astrocytoma 1493 0.00973676524313321
Disease Target Count Z-score Confidence
Crohn's disease 304 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Multiple chemical sensitivity 6 3.179 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.072 0.000
astrocytoma 1.200 0.010
medulloblastoma, large-cell -1.200 0.001
ovarian cancer -1.100 0.000

Synonym

Accession Q13107 A8K6Y0 C9IY91 O43452 O43453 Q08AK8
Symbols UNP
Unph

Gene

PDB

5CTR   2Y6E  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (21)

PMID Text
26669864 Results demonstrate that aberrant expression of USP4 contributes to the development and progression of colorectal cancer and reveal a critical mechanism underlying USP4-mediated oncogenic activity.
26455393 findings thus identify USP4 as a novel DNA repair regulator and invoke a model in which ubiquitin adducts regulate USP enzyme interactions and functions.
26387952 USP4 cooperates with CtIP in DNA double-strand break end resection.
26189775 USP4 knockdown in HCT116, a colon cancer cell line, reduced invasion and migration activity.
25821221 USP4 and IL-17 mRNA, but not RORgammat mRNA, were significantly elevated in CD4(+) T cells from patients with rheumatic heart disease
25404403 USP4 requires its N-terminal DUSP-Ubl domain to achieve full catalytic turnover by promoting ubiquitin exchange.
24798342 USP4 overexpression is associated with hepatocellular carcinoma.
23388719 Authors identified USP4 as a new positive regulator for RIG-I that acts through deubiquitinating K48-linked ubiquitin chains and stabilizing RIG-I.
23313255 Data suggest that USP4 down-regulates RIP1 (receptor-interacting serine-threonine kinase 1)-mediated TNFalpha (tumor necrosis factor-alpha) activation and promotes TNFalpha-induced apoptosis via deubiquitination of RIP1 in head/neck carcinoma.
23022198 the interaction with USP4 may regulate the structure and function of the proteasome or the turnover of specific proteasomal substrates.
More...

AA Sequence

MAEGGGCRERPDAETQKSELGPLMRTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVGEHNLFPGPID      1 - 70
NSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRKVVEHGLFVKHCKVEVYLLEL     71 - 140
KLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERETRLWNKYMSNTYEQLSKLDNTVQDAGLYQG    141 - 210
QVLVIEPQNEDGTWPRQTLQSKSSTAPSRNFTTSPKSSASPYSSVSASLIANGDSTSTCGMHSSGVSRGG    211 - 280
SGFSASYNCQEPPSSHIQPGLCGLGNLGNTCFMNSALQCLSNTAPLTDYFLKDEYEAEINRDNPLGMKGE    281 - 350
IAEAYAELIKQMWSGRDAHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFLLDGLHEDLNRVKKKPYLEL    351 - 420
KDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLPLPLKKDRVME    421 - 490
VFLVPADPHCRPTQYRVTVPLMGAVSDLCEALSRLSGIAAENMVVADVYNHRFHKIFQMDEGLNHIMPRD    491 - 560
DIFVYEVCSTSVDGSECVTLPVYFRERKSRPSSTSSASALYGQPLLLSVPKHKLTLESLYQAVCDRISRY    561 - 630
VKQPLPDEFGSSPLEPGACNGSRNSCEGEDEEEMEHQEEGKEQLSETEGSGEDEPGNDPSETTQKKIKGQ    631 - 700
PCPKRLFTFSLVNSYGTADINSLAADGKLLKLNSRSTLAMDWDSETRRLYYDEQESEAYEKHVSMLQPQK    701 - 770
KKKTTVALRDCIELFTTMETLGEHDPWYCPNCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDT    771 - 840
VVEFPIRGLNMSEFVCNLSARPYVYDLIAVSNHYGAMGVGHYTAYAKNKLNGKWYYFDDSNVSLASEDQI    841 - 910
VTKAAYVLFYQRRDDEFYKTPSLSSSGSSDGGTRPSSSQQGFGDDEACSMDTN                     911 - 963
//

Text Mined References (43)

PMID Year Title
26669864 2016 Ubiquitin-Specific Protease 4-Mediated Deubiquitination and Stabilization of PRL-3 Is Required for Potentiating Colorectal Oncogenesis.
26455393 2015 USP4 Auto-Deubiquitylation Promotes Homologous Recombination.
26387952 2015 The Deubiquitylating Enzyme USP4 Cooperates with CtIP in DNA Double-Strand Break End Resection.
26189775 2015 Ubiquitin specific protease 4 positively regulates the WNT/?-catenin signaling in colorectal cancer.
25821221 2015 Cutting edge: Ubiquitin-specific protease 4 promotes Th17 cell function under inflammation by deubiquitinating and stabilizing ROR?t.
25404403 2014 The DUSP-Ubl domain of USP4 enhances its catalytic efficiency by promoting ubiquitin exchange.
25082827 2014 A genome-wide association study identifies a novel locus at 6q22.1 associated with ulcerative colitis.
24798342 2014 microRNA-148a dysregulation discriminates poor prognosis of hepatocellular carcinoma in association with USP4 overexpression.
23388719 2013 USP4 positively regulates RIG-I-mediated antiviral response through deubiquitination and stabilization of RIG-I.
23313255 2013 Ubiquitin-specific protease 4 promotes TNF-?-induced apoptosis by deubiquitination of RIP1 in head and neck squamous cell carcinoma.
More...