Property Summary

NCBI Gene PubMed Count 51
Grant Count 15
R01 Count 11
Funding $1,270,437.97
PubMed Score 31.04
PubTator Score 42.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.400 0.000
ovarian cancer 1.100 0.000

 GWAS Trait (1)

Gene RIF (27)

PMID Text
26972249 This study presents the structure of the synthetic Miz-1 Zinc Finger 13 determined by 2D (1)H-(1)H NMR.
25558878 MIZ-1 can promote the proliferation of breast cancer cells through Wnt signaling.
24983942 results indicate that Miz-1 may be directed in vivo to the novel motif sequences we have identified, where it can recruit its specific binding partners to control gene expression and ultimately regulate cell fate
24618291 We demonstrate that Arnt is an interaction partner for Miz-1, and that Arnt has a functional role in the regulation of CDKN2B
24296348 The functional interaction of both proteins becomes apparent at oncogenic expression levels of MYC and association with MIZ-1 mediates both oncogenic functions of MYC as well as tumor-suppressive responses to oncogenic levels of MYC.
23570452 The ZBTB17 polymorphism rs10927875 appears to play a role in the susceptibility of the Han Chinese population to dilated cardiomyopathy .
22184250 The repression of TNF-alpha-induced JNK activation by Miz1 is de-repressed by its own site-specific ubiquitination and degradation.
22099967 study demonstrate that HPV-16 E7 forms a complex with Miz-1; These findings suggest that HPV-16 E7 protein can repress Miz-1-induced p21(Cip1) gene expression
21908575 NLRR3 is a direct target of MYCN, which associates with Miz-1 and negatively regulates NLRR3 expression.
20697356 Although the transient repression mediated by Miz-1/c-Myc is independent of de novo methylation, the stable repression by this complex is associated with CpG island methylation of the critical -295 to -95-bp region of the WIF-1 promoter
More...

AA Sequence

MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGL      1 - 70
GQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALATEGGDKRAKEE     71 - 140
KVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGAEQTEKADAPREPPPVELKPDPTSGMAAAEA    141 - 210
EAALSESSEQEMEVEPARKGEEEQKEQEEQEEEGAGPAEVKEEGSQLENGEAPEENENEESAGTDSGQEL    211 - 280
GSEARGLRSGTYGDRTESKAYGSVIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACK    281 - 350
AHEKTHSPLKPYGCEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQC    351 - 420
DYCGRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQFTTSGNLK    421 - 490
RHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQASSLIAHVRQHTGEKPYVC    491 - 560
ERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSKHIIIHTGEKPYLCDKCGRGFNRVDNLR    561 - 630
SHVKTVHQGKAGIKILEPEEGSEVSVVTVDDMVTLATEALAATAVTQLTVVPVGAAVTADETEVLKAEIS    631 - 700
KAVKQVQEEDPNTHILYACDSCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQ    701 - 770
AGELVFRPRDGAEGQPALAETSPTAPECPPPAE                                         771 - 803
//

Text Mined References (56)

PMID Year Title
26972249 2016 Solution structure of the 13th C2H2 Zinc Finger of Miz-1.
26766587 2016 The Interaction of Myc with Miz1 Defines Medulloblastoma Subgroup Identity.
25558878 2015 Myc-interacting zinc-finger protein 1 positively regulates Wnt signalling by protecting Dishevelled from Dapper1-mediated degradation.
25245946 2014 Two ZNF509 (ZBTB49) isoforms induce cell-cycle arrest by activating transcription of p21/CDKN1A and RB upon exposure to genotoxic stress.
24983942 2014 Miz-1 activates gene expression via a novel consensus DNA binding motif.
24912190 2014 Genome-wide RNAi screen identifies the Parkinson disease GWAS risk locus SREBF1 as a regulator of mitophagy.
24618291 2014 Regulation of CDKN2B expression by interaction of Arnt with Miz-1--a basis for functional integration between the HIF and Myc gene regulatory pathways.
24296348 2013 The role of MIZ-1 in MYC-dependent tumorigenesis.
23570452 2013 Polymorphism of ZBTB17 gene is associated with idiopathic dilated cardiomyopathy: a case control study in a Han Chinese population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...