Property Summary

NCBI Gene PubMed Count 17
PubMed Score 21.11
PubTator Score 26.22

Knowledge Summary

Patent

No data available

Synonym

Accession Q13103 A4QMV3 Q3B892 Q546M5 Spp-24
Symbols SPP24
SPP-24

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (8)

AA Sequence

MISRMEKMTMMMKILIMFALGMNYWSCSGFPVYDYDPSSLRDALSASVVKVNSQSLSPYLFRAFRSSLKR      1 - 70
VEVLDENNLVMNLEFSIRETTCRKDSGEDPATCAFQRDYYVSTAVCRSTVKVSAQQVQGVHARCSWSSST     71 - 140
SESYSSEEMIFGDMLGSHKWRNNYLFGLISDESISEQFYDRSLGIMRRVLPPGNRRYPNHRHRARINTDF    141 - 210
E//

Text Mined References (18)

PMID Year Title