Property Summary

NCBI Gene PubMed Count 14
Grant Count 2
Funding $77,063.75
PubMed Score 19.04
PubTator Score 26.22

Knowledge Summary

Patent

No data available

Synonym

Accession Q13103 A4QMV3 Q3B892 Q546M5 Spp-24
Symbols SPP24
SPP-24

Gene

 Grant Application (2)

Gene RIF (7)

PMID Text
26459573 the two mutations of SPP2 have dominant negative effects and cellular accumulation of Spp-24 might be particularly toxic to photoreceptors and/or retinal pigment epithelium. SPP2 has a new role in retinal degeneration.
25501958 Spp24 truncation products have effects on osteoblastic differentiation mediated by kinase pathways that are independent of exogenous BMP/TGF-beta cytokines.
25418420 Report describes a C-terminal fragment within SPP24 that is distinct from the cystatin domain and which independently binds to BMP-2 and TGF-beta. This fragment inhibited BMP-2 activity in an ectopic bone forming assay.
25339413 Spp24, or proteolytic products of Spp24, bind cytokines of the TGF-beta superfamily and also activate intracellular signaling pathways [review]
19375587 spp24 contains at least 2 single nucleotide polymorphisms. Given its mechanism of action and sequence variability, SPP24 may be an interesting candidate for future studies of the genetic regulation of bone mass.
19240061 Observational study of gene-disease association. (HuGE Navigator)
15062857 Results describe the localization of the human secreted phosphoprotein 24 gene, its structure and the start of transcription in liver.

AA Sequence

MISRMEKMTMMMKILIMFALGMNYWSCSGFPVYDYDPSSLRDALSASVVKVNSQSLSPYLFRAFRSSLKR      1 - 70
VEVLDENNLVMNLEFSIRETTCRKDSGEDPATCAFQRDYYVSTAVCRSTVKVSAQQVQGVHARCSWSSST     71 - 140
SESYSSEEMIFGDMLGSHKWRNNYLFGLISDESISEQFYDRSLGIMRRVLPPGNRRYPNHRHRARINTDF    141 - 210
E//

Text Mined References (16)

PMID Year Title
26459573 2015 SPP2 Mutations Cause Autosomal Dominant Retinitis Pigmentosa.
25501958 2015 Spp24 derivatives stimulate a Gi-protein coupled receptor-Erk1/2 signaling pathway and modulate gene expressions in W-20-17 cells.
25418420 2015 A carboxy terminal BMP/TGF-? binding site in secreted phosphoprotein 24 kD independently affects BMP-2 activity.
25339413 2015 The bone matrix protein secreted phosphoprotein 24 kD (Spp24): bone metabolism regulator and starting material for biotherapeutic materials.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21269460 2011 Initial characterization of the human central proteome.
20548944 2010 An integration of genome-wide association study and gene expression profiling to prioritize the discovery of novel susceptibility Loci for osteoporosis-related traits.
19375587 2009 Bone morphogenetic protein-2 activity is regulated by secreted phosphoprotein-24 kd, an extracellular pseudoreceptor, the gene for which maps to a region of the human genome important for bone quality.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
More...