Property Summary

NCBI Gene PubMed Count 24
Grant Count 100
R01 Count 66
Funding $8,895,165.8
PubMed Score 65.35
PubTator Score 41.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
posterior fossa group B ependymoma 1.900 0.000
group 3 medulloblastoma 1.400 0.000
ovarian cancer -1.400 0.000
chronic rhinosinusitis -1.356 0.011

Synonym

Accession Q13099 A2A491 B4DUS2 Q5SZJ6 Q8N719
Symbols DAF19
TG737
TTC10
hTg737
D13S1056E

Gene

PANTHER Protein Class (2)

Gene RIF (7)

PMID Text
24346024 subtle regulation of IFT and associated cilia structure, tunes the wnt response controlling stem cell differentiation.
22974282 this work suggests that Tg737 is involved in the invasion and migration of hepatoma cells under hypoxia, with the involvement of the polycystin-1, IL-8, and TGF-beta1 signaling pathway
22941275 A mutation in IFT88 causes a hitherto unknown human ciliopathy.
21441926 Data show that IFT88 depletion induces mitotic defects in human cultured cells, in kidney cells from the IFT88 mouse mutant Tg737(orpk) and in zebrafish embryos.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20300861 The results indicate that loss of heterozygosity of the tumor suppressor gene Tg737 may play an important role in the carcinogenetic mechanism of liver cancer stem cells.
17264151 IFT88 is a centrosomal protein regulating G1-S transition in non-ciliated cells.

AA Sequence

MKFTNTKVQMMQNVHLAPETDEDDLYSGYNDYNPIYDIEELENDAAFQQAVRTSHGRRPPITAKISSTAV      1 - 70
TRPIATGYGSKTSLASSIGRPMTGAIQDGVTRPMTAVRAAGFTKAALRGSAFDPLSQSRGPASPLEAKKK     71 - 140
DSPEEKIKQLEKEVNELVEESCIANSCGDLKLALEKAKDAGRKERVLVRQREQVTTPENINLDLTYSVLF    141 - 210
NLASQYSVNEMYAEALNTYQVIVKNKMFSNAGILKMNMGNIYLKQRNYSKAIKFYRMALDQVPSVNKQMR    211 - 280
IKIMQNIGVTFIQAGQYSDAINSYEHIMSMAPNLKAGYNLTICYFAIGDREKMKKAFQKLITVPLEIDED    281 - 350
KYISPSDDPHTNLVTEAIKNDHLRQMERERKAMAEKYIMTSAKLIAPVIETSFAAGYDWCVEVVKASQYV    351 - 420
ELANDLEINKAVTYLRQKDYNQAVEILKVLEKKDSRVKSAAATNLSALYYMGKDFAQASSYADIAVNSDR    421 - 490
YNPAALTNKGNTVFANGDYEKAAEFYKEALRNDSSCTEALYNIGLTYEKLNRLDEALDCFLKLHAILRNS    491 - 560
AEVLYQIANIYELMENPSQAIEWLMQVVSVIPTDPQVLSKLGELYDREGDKSQAFQYYYESYRYFPCNIE    561 - 630
VIEWLGAYYIDTQFWEKAIQYFERASLIQPTQVKWQLMVASCFRRSGNYQKALDTYKDTHRKFPENVECL    631 - 700
RFLVRLCTDLGLKDAQEYARKLKRLEKMKEIREQRIKSGRDGSGGSRGKREGSASGDSGQNYSASSKGER    701 - 770
LSARLRALPGTNEPYESSSNKEIDASYVDPLGPQIERPKTAAKKRIDEDDFADEELGDDLLPE           771 - 833
//

Text Mined References (27)

PMID Year Title
25564561 2015 The kinetochore protein, CENPF, is mutated in human ciliopathy and microcephaly phenotypes.
24421332 2014 The CP110-interacting proteins Talpid3 and Cep290 play overlapping and distinct roles in cilia assembly.
24346024 2013 Surface topography regulates wnt signaling through control of primary cilia structure in mesenchymal stem cells.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
22974282 2012 Tg737 signaling is required for hypoxia-enhanced invasion and migration of hepatoma cells.
22941275 2012 Gene therapy rescues cilia defects and restores olfactory function in a mammalian ciliopathy model.
21441926 2011 The cilia protein IFT88 is required for spindle orientation in mitosis.
20713499 2010 Cross-disorder genomewide analysis of schizophrenia, bipolar disorder, and depression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...