Property Summary

NCBI Gene PubMed Count 25
PubMed Score 38.26
PubTator Score 31.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
malignant mesothelioma 3163 7.72571188355437E-6

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.200 0.000

Synonym

Accession Q13098 Q8NA10 Q9BWL1 SGN1
Symbols CSN1
SGN1
COPS1

Gene

PDB

4D10   4D18   4WSN  

  Ortholog (11)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (5)

PMID Text
23408908 We analyzed whether CSN1 alone can increase DEN1 degradation in HeLa cells.these data suggest that the COP9 signalosome supports proteasome-dependent protein degradation of DEN1/DenA in fungi and in human cells.
22190034 HIV-1 Vpr is identified to have a physical interaction with G protein pathway suppressor 1 (GPS1; COPS1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22103747 An increased level of CSN1 and CSN5 as an important part of the ubiquitin proteasome system (UPS) might be associated with the pathophysiology of preeclampsia.
21604193 CSN1 inhibits c-Jun phosphorylation without affecting its protein stability.
11114242 The N-terminal half of CSN1/GPS1 is required to repress c-fos expression and to inhibit AP-1 and SRE transactivation, while the C-terminal half allows integration of the protein into the COP9 signalosome.

AA Sequence

MPLPVQVFNLQGAVEPMQIDVDPQEDPQNAPDVNYVVENPSLDLEQYAASYSGLMRIERLQFIADHCPTL      1 - 70
RVEALKMALSFVQRTFNVDMYEEIHRKLSEATRSSLRELQNAPDAIPESGVEPPALDTAWVEATRKKALL     71 - 140
KLEKLDTDLKNYKGNSIKESIRRGHDDLGDHYLDCGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSV    141 - 210
YLQNWSHVLSYVSKAESTPEIAEQRGERDSQTQAILTKLKCAAGLAELAARKYKQAAKCLLLASFDHCDF    211 - 280
PELLSPSNVAIYGGLCALATFDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKD    281 - 350
NLLLDMYLAPHVRTLYTQIRNRALIQYFSPYVSADMHRMAAAFNTTVAALEDELTQLILEGLISARVDSH    351 - 420
SKILYARDVDQRSTTFEKSLLMGKEFQRRAKAMMLRAAVLRNQIHVKSPPREGSQGELTPANSQSRMSTN    421 - 490
M//

Text Mined References (34)

PMID Year Title
24421388 2014 Dynamic regulation of the COP9 signalosome in response to DNA damage.
23408908 2013 Control of multicellular development by the physically interacting deneddylases DEN1/DenA and COP9 signalosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22103747 2012 Altered expression of COP9 signalosome proteins in preeclampsia.
21604193 2011 CSN1 inhibits c-Jun phosphorylation and down-regulates ectopic expression of JNK1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19615732 2009 Defining the human deubiquitinating enzyme interaction landscape.
More...