Property Summary

NCBI Gene PubMed Count 116
Grant Count 187
R01 Count 105
Funding $28,881,242.51
PubMed Score 172.45
PubTator Score 128.91

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13094 A8KA25 Q53XV4
Symbols SLP76
SLP-76

Gene

PANTHER Protein Class (1)

PDB

2ROR   1H3H   1YWO   2EAP  

Gene RIF (58)

PMID Text
26321253 immune cell adaptor SLP-76 binds directly to SUMO-RanGAP1 of cytoplasmic fibrils of the nuclear pore complex, and this interaction is needed for optimal NFATc1 and NF-kappaB p65 nuclear entry in T cells
26202465 Data strongly suggest that chemokine-stimulated associations between Vav1, SLP-76, and ADAP facilitate Rac1 activation and alpha4beta1-mediated adhesion, whereas Pyk2 opposes this adhesion by limiting Rac1 activation.
26163016 TSAD binds to and co-localizes with Nck. Expression of TSAD increases both Nck-Lck and Nck-SLP-76 interaction in T cells.
25316710 SLP-76 N-terminal tyrosine residues regulate a dynamic signaling equilibrium involving feedback of proximal T-cell receptor signaling
24162774 HIV-1 gp120 upregulates the expression of lymphocyte cytosolic protein 2 (LCP2, SLP76) in human B cells
23979596 Multipoint binding of SLP-76 to ADAP facilitates the assembly of SLP-76 microclusters.
23935094 Data indicate a role for the SAM domain in mediating SLP-76 self-association for T-cell function.
23901140 analysis of a costimulatory mechanism by which CXCL12 and antigen converge at SLP-76 microcluster formation to enhance T cell responses
23293025 Data indicate that the intracellular signaling of ITK-SYK requires both SLP-76 and the adapter function of SYK/ZAP-70 kinases.
23227982 HIV-1 gp120 upregulates the expression of lymphocyte cytosolic protein 2 (LCP2, SLP76) in human B cells
More...

AA Sequence

MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQ      1 - 70
EINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVE     71 - 140
DDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLP    141 - 210
PPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLP    211 - 280
KIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPS    281 - 350
PMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNE    351 - 420
EWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLR    421 - 490
GKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP                               491 - 533
//

Text Mined References (120)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26321253 2015 The Immune Adaptor SLP-76 Binds to SUMO-RANGAP1 at Nuclear Pore Complex Filaments to Regulate Nuclear Import of Transcription Factors in T Cells.
26202465 2015 Positive and negative regulation by SLP-76/ADAP and Pyk2 of chemokine-stimulated T-lymphocyte adhesion mediated by integrin ?4?1.
26163016 2015 T cell specific adaptor protein (TSAd) promotes interaction of Nck with Lck and SLP-76 in T cells.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
25316710 2015 SRC homology 2 domain-containing leukocyte phosphoprotein of 76 kDa (SLP-76) N-terminal tyrosine residues regulate a dynamic signaling equilibrium involving feedback of proximal T-cell receptor (TCR) signaling.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24584089 2014 Quantitative proteomics analysis of signalosome dynamics in primary T cells identifies the surface receptor CD6 as a Lat adaptor-independent TCR signaling hub.
More...