Property Summary

NCBI Gene PubMed Count 116
PubMed Score 172.45
PubTator Score 128.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 2.57678848119204E-33
non-small cell lung cancer 2798 3.08150876090995E-11
lung cancer 4473 5.47005325025279E-6
ulcerative colitis 2087 8.88664844182633E-6
medulloblastoma, large-cell 6234 1.45070785313555E-5
pilocytic astrocytoma 3086 3.48269741206371E-5
psoriasis 6685 3.88219375375812E-5
ovarian cancer 8492 1.54306908767038E-4
primary Sjogren syndrome 789 3.27284870374989E-4
glioblastoma 5572 3.67128808020916E-4
cutaneous lupus erythematosus 1056 3.79882950644581E-4
interstitial cystitis 2299 9.67902018895038E-4
invasive ductal carcinoma 2950 0.00103032789089329
posterior fossa group A ependymoma 1511 0.001370469851439
osteosarcoma 7933 0.0113639398042651
Rheumatoid Arthritis 1171 0.0122057732623777
head and neck cancer and chronic obstructive pulmonary disease 237 0.0127670082393523
pediatric high grade glioma 2712 0.0134808726430045
subependymal giant cell astrocytoma 2287 0.0144844991978342
adrenocortical carcinoma 1427 0.0158273004265566
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0220408851905021
astrocytoma 1493 0.0370158399538431
sarcoidosis 368 0.0417853266109286
Disease Target Count Z-score Confidence
Agammaglobulinemia 24 3.056 1.5

Expression

Synonym

Accession Q13094 A8KA25 Q53XV4
Symbols SLP76
SLP-76

Gene

PANTHER Protein Class (1)

PDB

2ROR   1H3H   1YWO   2EAP  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (56)

PMID Text
26321253 immune cell adaptor SLP-76 binds directly to SUMO-RanGAP1 of cytoplasmic fibrils of the nuclear pore complex, and this interaction is needed for optimal NFATc1 and NF-kappaB p65 nuclear entry in T cells
26202465 Data strongly suggest that chemokine-stimulated associations between Vav1, SLP-76, and ADAP facilitate Rac1 activation and alpha4beta1-mediated adhesion, whereas Pyk2 opposes this adhesion by limiting Rac1 activation.
26163016 TSAD binds to and co-localizes with Nck. Expression of TSAD increases both Nck-Lck and Nck-SLP-76 interaction in T cells.
25316710 SLP-76 N-terminal tyrosine residues regulate a dynamic signaling equilibrium involving feedback of proximal T-cell receptor signaling
24162774 HIV-1 gp120 upregulates the expression of lymphocyte cytosolic protein 2 (LCP2, SLP76) in human B cells
23979596 Multipoint binding of SLP-76 to ADAP facilitates the assembly of SLP-76 microclusters.
23935094 Data indicate a role for the SAM domain in mediating SLP-76 self-association for T-cell function.
23901140 analysis of a costimulatory mechanism by which CXCL12 and antigen converge at SLP-76 microcluster formation to enhance T cell responses
23293025 Data indicate that the intracellular signaling of ITK-SYK requires both SLP-76 and the adapter function of SYK/ZAP-70 kinases.
23227982 HIV-1 gp120 upregulates the expression of lymphocyte cytosolic protein 2 (LCP2, SLP76) in human B cells
More...

AA Sequence

MALRNVPFRSEVLGWDPDSLADYFKKLNYKDCEKAVKKYHIDGARFLNLTENDIQKFPKLRVPILSKLSQ      1 - 70
EINKNEERRSIFTRKPQVPRFPEETESHEEDNGGWSSFEEDDYESPNDDQDGEDDGDYESPNEEEEAPVE     71 - 140
DDADYEPPPSNDEEALQNSILPAKPFPNSNSMYIDRPPSGKTPQQPPVPPQRPMAALPPPPAGRNHSPLP    141 - 210
PPQTNHEEPSRSRNHKTAKLPAPSIDRSTKPPLDRSLAPFDREPFTLGKKPPFSDKPSIPAGRSLGEHLP    211 - 280
KIQKPPLPPTTERHERSSPLPGKKPPVPKHGWGPDRRENDEDDVHQRPLPQPALLPMSSNTFPSRSTKPS    281 - 350
PMNPLPSSHMPGAFSESNSSFPQSASLPPYFSQGPSNRPPIRAEGRNFPLPLPNKPRPPSPAEEENSLNE    351 - 420
EWYVSYITRPEAEAALRKINQDGTFLVRDSSKKTTTNPYVLMVLYKDKVYNIQIRYQKESQVYLLGTGLR    421 - 490
GKEDFLSVSDIIDYFRKMPLLLIDGKNRGSRYQCTLTHAAGYP                               491 - 533
//

Text Mined References (120)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26321253 2015 The Immune Adaptor SLP-76 Binds to SUMO-RANGAP1 at Nuclear Pore Complex Filaments to Regulate Nuclear Import of Transcription Factors in T Cells.
26202465 2015 Positive and negative regulation by SLP-76/ADAP and Pyk2 of chemokine-stimulated T-lymphocyte adhesion mediated by integrin ?4?1.
26163016 2015 T cell specific adaptor protein (TSAd) promotes interaction of Nck with Lck and SLP-76 in T cells.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25416956 2014 A proteome-scale map of the human interactome network.
25316710 2015 SRC homology 2 domain-containing leukocyte phosphoprotein of 76 kDa (SLP-76) N-terminal tyrosine residues regulate a dynamic signaling equilibrium involving feedback of proximal T-cell receptor (TCR) signaling.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24584089 2014 Quantitative proteomics analysis of signalosome dynamics in primary T cells identifies the surface receptor CD6 as a Lat adaptor-independent TCR signaling hub.
More...