Property Summary

NCBI Gene PubMed Count 214
Grant Count 98
R01 Count 65
Funding $10,147,125.51
PubMed Score 299.96
PubTator Score 783.44

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis -1.200 0.009
cutaneous lupus erythematosus 2.700 0.000
COPD 2.300 0.036
Atopic dermatitis -1.300 0.021
tuberculosis and treatment for 6 months -2.700 0.000
sarcoidosis 2.900 0.045
interstitial cystitis 3.200 0.001
lung adenocarcinoma 1.900 0.000
pilocytic astrocytoma 1.100 0.001
primary Sjogren syndrome 1.500 0.000
nasopharyngeal carcinoma 1.600 0.000
lung carcinoma -2.300 0.000
non-small cell lung carcinoma 1.800 0.000
ductal carcinoma in situ 2.100 0.006
invasive ductal carcinoma 2.300 0.002
ulcerative colitis 2.400 0.000

Synonym

Accession Q13093 A5HTT5 Q15692 Q5VTT1 Q8IVA2 PAF acetylhydrolase
Symbols PAFAD
PAFAH
LP-PLA2
LDL-PLA2

Gene

PANTHER Protein Class (2)

PDB

3D59   3D5E   3F96   3F97   3F98   3F9C   5I8P   5I9I   5JAD   5JAH   5JAL   5JAN   5JAO   5JAP   5JAR   5JAS   5JAT   5JAU  

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
463082 screening 4934 / 0 / 321202 Fluorescence polarization-based primary biochemical high throughput screening assay to identify inhibitors of the plasma platelet activating factor acetylhydrolase (pPAFAH)
463230 screening 1675 / 0 / 666 Fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of the plasma platelet activating factor acetylhydrolase (pPAFAH; PLA2G7)
588766 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of plasma platelet activating factor acetylhydrolase (pPAFAH): fluorescence-based dose response biochemical gel-based competitive Activity-Based Protein Profiling (ABPP) inhibition of human pPAFAH
588788 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of pPAFAH: LC-MS/MS-based biochemical assay to determine binding mode of test compounds
624355 other 0 / 0 / 0 Late stage results from the probe development efforts to identify dual inhibitors of signal transducer and activator of transcription 3 (STAT3) and nuclear factor NF-kappa-B (NF-kB): Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs
624406 other 0 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of Hepatitis C Virus (HCV) core protein dimerization: Cell-based radioligand binding assay to determine the binding affinities for selected transporters, receptors, and GPCRs

Gene RIF (210)

PMID Text
26848158 Higher Lp-PLA2 mass and activity were associated with development of both incident clinical peripheral arterial disease and low ankle brachial index.
26801405 Increased plasma Lp-PLA2 activity portends increased risk of resistant hypertension.
26791069 A V279F loss-of-function variant in the PLA2G7 gene resulting in 50% lower activity for each copy of the variant, is common in East Asians and associated with risk of Vascular diseases.
26642708 circulating CETP and Lp-PLA2 might partly play a role in the atherogenic disturbances in patients with iron deficiency anemia through increased susceptibility to lipid peroxidation
26595893 279Val-->Phe Polymorphism of Lp-PLA2 may lead to decrease the enzymatic activity via changes of folding kinetics and recognition to its substrate.
26504820 Studied whether the level of Lp-PLA2 is associated with subclinical atherosclerosis in patients with rheumatoid arthritis.
26311748 Higher levels of Lp-PLA2-A in the acute period after TIA or minor stroke are associated with increased short-term risk of recurrent vascular events.
26117401 Lipoprotein associated phospholipase A2 activity and apolipoprotein C3 loss-of-function variants are involved in cardiovascular disease
26004387 In multi-ethnic cohort, Lp-PLA2 was positively associated with CVD risk, regardless of the presence of coronary artery calcium or a thickened carotid-intimal media.
25934512 Lp-PLA2 concentrations were positively associated with all LDL subfractions and small HDL subfraction, suggesting an interaction between Lp-PLA2 and lipoprotein subfraction phenotypes in the status of coronary artery disease.
More...

AA Sequence

MVPPKLHVLFCLCGCLAVVYPFDWQYINPVAHMKSSAWVNKIQVLMAAASFGQTKIPRGNGPYSVGCTDL      1 - 70
MFDHTNKGTFLRLYYPSQDNDRLDTLWIPNKEYFWGLSKFLGTHWLMGNILRLLFGSMTTPANWNSPLRP     71 - 140
GEKYPLVVFSHGLGAFRTLYSAIGIDLASHGFIVAAVEHRDRSASATYYFKDQSAAEIGDKSWLYLRTLK    141 - 210
QEEETHIRNEQVRQRAKECSQALSLILDIDHGKPVKNALDLKFDMEQLKDSIDREKIAVIGHSFGGATVI    211 - 280
QTLSEDQRFRCGIALDAWMFPLGDEVYSRIPQPLFFINSEYFQYPANIIKMKKCYSPDKERKMITIRGSV    281 - 350
HQNFADFTFATGKIIGHMLKLKGDIDSNVAIDLSNKASLAFLQKHLGLHKDFDQWDCLIEGDDENLIPGT    351 - 420
NINTTNQHIMLQNSSGIEKYN                                                     421 - 441
//

Text Mined References (216)

PMID Year Title
26848158 2016 Lipoprotein-Associated Phospholipase A2 and Incident Peripheral Arterial Disease in Older Adults: The Cardiovascular Health Study.
26801405 2016 Increased Lipoprotein-associated phospholipase A2 activity portends an increased risk of resistant hypertension.
26791069 2016 Lipoprotein-Associated Phospholipase A2 Loss-of-Function Variant and Risk of Vascular Diseases in 90,000 Chinese Adults.
26642708 2015 The Relationship Between Lipoprotein-Associated Phospholipase A(2), Cholesteryl Ester Transfer Protein and Lipid Profile and Risk of Atherosclerosis in Women with Iron Deficiency Anaemia.
26595893 2015 279(Val?Phe) Polymorphism of lipoprotein-associated phospholipase A(2) resulted in changes of folding kinetics and recognition to substrate.
26504820 2015 Is Lipoprotein-Associated Phospholipase A2 a Link between Inflammation and Subclinical Atherosclerosis in Rheumatoid Arthritis?
26311748 2015 Association of Lp-PLA2-A and early recurrence of vascular events after TIA and minor stroke.
26117401 2015 Lipoprotein associated phospholipase A2 activity, apolipoprotein C3 loss-of-function variants and cardiovascular disease: The Atherosclerosis Risk In Communities Study.
26004387 2015 Lipoprotein-associated phospholipase A2 and risk of incident cardiovascular disease in a multi-ethnic cohort: The multi ethnic study of atherosclerosis.
25934512 2015 Relationship between plasma phospholipase A2 concentrations and lipoprotein subfractions in patients with stable coronary artery disease.
More...