Property Summary

NCBI Gene PubMed Count 19
Grant Count 135
R01 Count 74
Funding $8,684,096.67
PubMed Score 10.68
PubTator Score 4.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.200 0.003
diabetes mellitus -1.200 0.001

Synonym

Accession Q13084 B2RCM4 D3DU46 Q4TT39 Q96S26 Q9BQD8 Q9BR04 L28mt
Symbols p15
MAAT1

Gene

PDB

3J7Y  

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIY      1 - 70
FPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYG     71 - 140
LDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEE    141 - 210
AIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ                            211 - 256
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20601428 2010 Properties of the C-terminal tail of human mitochondrial inner membrane protein Oxa1L and its interactions with mammalian mitochondrial ribosomes.
19753307 2009 Oxygen consumption can regulate the growth of tumors, a new perspective on the Warburg effect.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...