Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.80
PubTator Score 4.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 1.0e-03
psoriasis 6694 3.3e-03
Disease Target Count Z-score Confidence
Gastroparesis 22 3.401 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.200 1.0e-03
psoriasis 1.200 3.3e-03

Gene RIF (1)

AA Sequence

MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIY      1 - 70
FPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYG     71 - 140
LDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEE    141 - 210
AIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ                            211 - 256
//

Text Mined References (21)

PMID Year Title