Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.68
PubTator Score 4.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
diabetes mellitus 1663 0.00104821351867176
psoriasis 6685 0.00330396568669763
Disease Target Count Z-score Confidence
Gastroparesis 20 3.413 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.200 0.003
diabetes mellitus -1.200 0.001

Synonym

Accession Q13084 B2RCM4 D3DU46 Q4TT39 Q96S26 Q9BQD8 Q9BR04 L28mt
Symbols p15
MAAT1

Gene

PDB

3J7Y  

  Ortholog (11)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid

Gene RIF (1)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPLHKYPVWLWKRLQLREGICSRLPGHYLRSLEEERTPTPVHYRPHGAKFKINPKNGQRERVEDVPIPIY      1 - 70
FPPESQRGLWGGEGWILGQIYANNDKLSKRLKKVWKPQLFEREFYSEILDKKFTVTVTMRTLDLIDEAYG     71 - 140
LDFYILKTPKEDLCSKFGMDLKRGMLLRLARQDPQLHPEDPERRAAIYDKYKEFAIPEEEAEWVGLTLEE    141 - 210
AIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ                            211 - 256
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20601428 2010 Properties of the C-terminal tail of human mitochondrial inner membrane protein Oxa1L and its interactions with mammalian mitochondrial ribosomes.
19753307 2009 Oxygen consumption can regulate the growth of tumors, a new perspective on the Warburg effect.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...