Property Summary

NCBI Gene PubMed Count 152
Grant Count 43
R01 Count 39
Funding $2,314,948.71
PubMed Score 134.80
PubTator Score 120.82

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.366 0.001
glioblastoma 1.200 0.000
tuberculosis -1.900 0.000
interstitial cystitis 1.500 0.005
ulcerative colitis 1.100 0.000

 GWAS Trait (1)

Gene RIF (101)

PMID Text
25996949 Data suggest that, during B-cell transformation by Epstein-Barr virus, LMP1 (EBV latent membrane protein 1) induces signaling that stimulates Lys63-polyubiquitin chain attachment to TRAF1 (TNF receptor-associated factor 1) in the B-lymphocytes.
25834819 This study did not replicate the association between PTPRC and the response to anti-TNF treatment in our Southern European population. We found that TRAF1/C5 risk RA variants potentially influence anti-TNF treatment response.
25566937 Rs2900180 in C5-TRAF1 and linked variants in a 66Kb region were associated with radiographic progression in ACPA-negative RA
25533804 TRAF1-ALK translocation contributes to neoplastic phenotype in anaplastic large-cell lymphoma.
25500258 TRAF1/C5 rs10818488 polymorphism is not a genetic risk factor for acquired aplastic anemia in a Chinese population.
24952347 DNMT3L can address DNMT3A/B to specific sites by directly interacting with TFs that do not directly interact with DNMT3A/B
24338224 These findings suggest that the rs0818488 in TRAF1/C5 region is not associated with rheumatoid arthritis in Iranian population.
24321457 Single nucleotide polymorphism of TRAF1 predicts the clinical response to anti-TNF treatment in Japanese patients with rheumatoid arthritis.
24234752 Genetic polymorphism rs10818488 in TRAF1/C5 gene might be associated with rheumatoid arthritis susceptibility. [Meta-analysis]
24144456 genetic polymorphism is associated with rheumatoid arthritis susceptibility in Europeans Read More: http://informahealthcare.com/doi/full/10.3109/08820139.2013.837917
More...

AA Sequence

MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGEDLQSISPGSR      1 - 70
LRTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLLGFMKQWKARLGCGLESGPMA     71 - 140
LEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEA    141 - 210
SHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRC    211 - 280
HESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLL    281 - 350
DQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST        351 - 416
//

Text Mined References (160)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25996949 2015 TRAF1 Coordinates Polyubiquitin Signaling to Enhance Epstein-Barr Virus LMP1-Mediated Growth and Survival Pathway Activation.
25834819 2015 TRAF1/C5 but not PTPRC variants are potential predictors of rheumatoid arthritis response to anti-tumor necrosis factor therapy.
25566937 2015 A genetic study on C5-TRAF1 and progression of joint damage in rheumatoid arthritis.
25533804 2015 A novel patient-derived tumorgraft model with TRAF1-ALK anaplastic large-cell lymphoma translocation.
25500258 2015 TRAF1/C5 rs10818488 polymorphism is not a genetic risk factor for acquired aplastic anemia in a Chinese population.
25416956 2014 A proteome-scale map of the human interactome network.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24952347 2014 DNMT3L interacts with transcription factors to target DNMT3L/DNMT3B to specific DNA sequences: role of the DNMT3L/DNMT3B/p65-NF?B complex in the (de-)methylation of TRAF1.
24782177 2014 Novel risk loci for rheumatoid arthritis in Han Chinese and congruence with risk variants in Europeans.
More...