Property Summary

NCBI Gene PubMed Count 161
PubMed Score 138.68
PubTator Score 120.82

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.200 1.3e-04
interstitial cystitis 1.500 4.7e-03
osteosarcoma -1.366 9.2e-04
tuberculosis -1.900 1.2e-09
ulcerative colitis 1.100 2.3e-04

Gene RIF (110)

AA Sequence

MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGEDLQSISPGSR      1 - 70
LRTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLLGFMKQWKARLGCGLESGPMA     71 - 140
LEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEA    141 - 210
SHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQALGKLEQSLRLMEEASFDGTFLWKITNVTRRC    211 - 280
HESACGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGTGKRTHLSLFIVIMRGEYDALLPWPFRNKVTFMLL    281 - 350
DQNNREHAIDAFRPDLSSASFQRPQSETNVASGCPLFFPLSKLQSPKHAYVKDDTMFLKCIVETST        351 - 416
//

Text Mined References (169)

PMID Year Title