Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q13070 GAGE-6
Symbols CT4.6

Gene

 Compartment GO Term (0)

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGP      1 - 70
KPEADSQEQGHPQTGCECEDGPDGQEVDPPNPEEVKTPEEGEKQSQC                            71 - 117
//

Text Mined References (4)

PMID Year Title