Property Summary

NCBI Gene PubMed Count 6
PubMed Score 7.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Cancer 2499 3.08 1.5

Synonym

Accession Q13068 A8MU85 Q6NT33 GAGE-4
Symbols CT4.4

Gene

 Compartment GO Term (0)

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGP      1 - 70
KPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEGQSQC                            71 - 117
//

Text Mined References (7)

PMID Year Title