Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Peripheral Neuropathy 303

Synonym

Accession Q13067 GAGE-3
Symbols CT4.3

Gene

 Compartment GO Term (0)

AA Sequence

MNLSRGKSTYYWPRPRRYVQPPEVIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQG      1 - 70
PKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC                           71 - 118
//

Text Mined References (5)

PMID Year Title
18179644 2008 An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.
12522270 2003 Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry.
10397259 1999 Characterization of the GAGE genes that are expressed in various human cancers and in normal testis.
9651357 1998 Isolation and characterization of PAGE-1 and GAGE-7. New genes expressed in the LNCaP prostate cancer progression model that share homology with melanoma-associated antigens.
7544395 1995 A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.