Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.31
PubTator Score 1.21

Knowledge Summary

Patent

No data available

Synonym

Accession Q13066 C9K0W9 Q4V322 GAGE-2B
Symbols CT4.2
GAGE-2
GAGE-2B

Gene

 Compartment GO Term (1)

AA Sequence

MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPK      1 - 70
PEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC                             71 - 116
//

Text Mined References (5)

PMID Year Title
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18179644 2008 An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
7544395 1995 A new family of genes coding for an antigen recognized by autologous cytolytic T lymphocytes on a human melanoma.