Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.29
PubTator Score 1.21

Knowledge Summary

Patent

No data available

Synonym

Accession Q13066 C9K0W9 Q4V322 GAGE-2B
Symbols CT4.2
GAGE-2
GAGE-2B

Gene

 Compartment GO Term (1)

AA Sequence

MSWRGRSTYRPRPRRYVEPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPK      1 - 70
PEAHSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEGEKQSQC                             71 - 116
//

Text Mined References (5)

PMID Year Title