Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.87
PubTator Score 11.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Adenocarcinoma 122 0.0 0.0
Pancreatic Neoplasms 85 0.0 0.0
Disease Target Count
Pancreatic Neoplasm 85
Disease Target Count P-value
osteosarcoma 7950 2.2e-03
Disease Target Count Z-score Confidence
Cancer 2499 3.054 1.5

Gene RIF (2)

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGP      1 - 70
KPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQTGILWLLMNNCFLNLSPRKP      71 - 139
//

Text Mined References (17)

PMID Year Title