Property Summary

NCBI Gene PubMed Count 16
PubMed Score 6.90
PubTator Score 11.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (4)

Synonym

Accession Q13065 GAGE-1
Symbols CT4.1
GAGE-1

Gene

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
20423514 Tumor-specific antigen GAGE may play a role in the occurrence and development of ovarian cancer and can be used as one of the important indicators for early diagnosis, efficacy evaluation and prognostic determination of ovarian cancer.
17208940 MAGE-A1 and NY-ESO-1 are associated with highly proliferating germ cells, whereas GAGE proteins have a more general function in germ cells unrelated to any specific developmental stage

AA Sequence

MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGP      1 - 70
KPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQTGILWLLMNNCFLNLSPRKP      71 - 139
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20423514 2010 Expression of tumor-specific antigen MAGE, GAGE and BAGE in ovarian cancer tissues and cell lines.
20053773 2010 Global methylation pattern of genes in androgen-sensitive and androgen-independent prostate cancer cells.
18179644 2008 An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.
17715884 2007 Expression of cancer-testis (CT) antigens in placenta.
17709385 2007 Acetylation-induced transcription is required for active DNA demethylation in methylation-silenced genes.
17208940 2007 MAGE-A1, GAGE and NY-ESO-1 cancer/testis antigen expression during human gonadal development.
16929165 2006 Expression of cancer-testis antigens as possible targets for antigen-specific immunotherapy in head and neck squamous cell carcinoma.
15772651 2005 The DNA sequence of the human X chromosome.
15362791 The expression of GAGE gene can predict aggressive biologic behavior of intestinal type of stomach cancer.
More...