Property Summary

NCBI Gene PubMed Count 24
Grant Count 104
R01 Count 75
Funding $15,976,571.43
PubMed Score 139.26
PubTator Score 25.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma -1.455 0.000
lung cancer 1.300 0.000

Synonym

Accession Q13057 B2RA78 B4DLU0 Q6GS23 Q8NBM7 Q8NEW1 Q8WXD4 Q9NRM3 CoA synthase
Symbols NBP
DPCK
PPAT
UKR1
NBIA6
pOV-2

Gene

PANTHER Protein Class (2)

Gene RIF (9)

PMID Text
25668476 Mutations in PANK2 and CoASY lead, respectively, to PKAN and CoPAN forms of Neurodegeneration with brain iron accumulation . Mutations in PLA2G6 lead to PLAN. Mutations in C19orf12 lead to MPAN
24360804 Exome sequencing revealed the presence of recessive missense mutations in COASY, encoding coenzyme A (CoA) synthase in neurodegeneration with brain iron accumulation
22982864 EDC4 might contribute to regulation of CoA biosynthesis in addition to its scaffold function in processing bodies
19692168 Observational study of gene-disease association. (HuGE Navigator)
19482007 CoA synthase is involved in signaling events in the cell and forms a functional complex with p85alphaPI3K in vivo.
18854154 Knockdown of CoA synthase (COASY) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18820009 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16460672 description of the existence of a novel CoA synthase isoform, which is the product of alternative splicing and possesses a 29aa extension at the N-terminus; termed it CoASy beta
11994049 Identification and characterization of the gene encoding the human phosphopantetheine adenylyltransferase and dephospho-CoA kinase bifunctional enzyme (CoA synthase).

AA Sequence

MAVFRSGLLVLTTPLASLAPRLASILTSAARLVNHTLYVHLQPGMSLEGPAQPQSSPVQATFEVLDFITH      1 - 70
LYAGADVHRHLDVRILLTNIRTKSTFLPPLPTSVQNLAHPPEVVLTDFQTLDGSQYNPVKQQLVRYATSC     71 - 140
YSCCPRLASVLLYSDYGIGEVPVEPLDVPLPSTIRPASPVAGSPKQPVRGYYRGAVGGTFDRLHNAHKVL    141 - 210
LSVACILAQEQLVVGVADKDLLKSKLLPELLQPYTERVEHLSEFLVDIKPSLTFDVIPLLDPYGPAGSDP    211 - 280
SLEFLVVSEETYRGGMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYE    281 - 350
RPELPTCLYVIGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGI    351 - 420
INRKVLGSRVFGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQNLVHEVWTAV    421 - 490
IPETEAVRRIVERDGLSEAAAQSRLQSQMSGQQLVEQSHVVLSTLWEPHITQRQVEKAWALLQKRIPKTH    491 - 560
QALD                                                                      561 - 564
//

Text Mined References (30)

PMID Year Title
25668476 2015 Mitochondria: A crossroads for lipid metabolism defect in neurodegeneration with brain iron accumulation diseases.
25416956 2014 A proteome-scale map of the human interactome network.
24360804 2014 Exome sequence reveals mutations in CoA synthase as a cause of neurodegeneration with brain iron accumulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22982864 2012 EDC4 interacts with and regulates the dephospho-CoA kinase activity of CoA synthase.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19482007 2009 CoA synthase is in complex with p85alphaPI3K and affects PI3K signaling pathway.
More...