Property Summary

NCBI Gene PubMed Count 53
Grant Count 66
R01 Count 37
Funding $5,500,591.71
PubMed Score 85.44
PubTator Score 42.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
acute quadriplegic myopathy 1.186 0.000
lung cancer 1.300 0.030
group 4 medulloblastoma -1.100 0.021
subependymal giant cell astrocytoma -1.993 0.022
ovarian cancer 1.100 0.000

Synonym

Accession Q13049 Q9NQP8
Symbols HT2A
BBS11
TATIP
LGMD2H

Gene

PDB

2CT2   5FEY  

Gene RIF (32)

PMID Text
26514622 Studies indicate most-studied TRIpartite Motif (TRIM)-NHL proteins TRIM2, TRIM3, TRIM32 and TRIM71, and their mutations have been linked to diseases.
26394407 Results suggest that Salmonella effector SseK3 binding to host tripartite motif-containing 32 protein (TRIM32) in the inhibition of nuclear factor kappa B (NF-kappaB) activation: [SseK3]
26057645 TRIM32 represents a model of intrinsic immunity, in which a host protein directly senses and counters viral infection in a species specific fashion by directly limiting viral replication
25873391 TRIM32, an E3 ubiquitin ligase, promotes HIV reactivation from latency by directly modifying IkappaBalpha
25351777 Data indicate that variants in tripartite motif-containing 32 protein (TRIM32) in two patients presenting nonspecific limb-girdle muscular dystrophy type 2H (LGMD2H) were identified by using high-throughput variants screening techniques.
25146927 Identification of TRIM32 as a novel p53 target and as a novel negative regulator for p53.
25100564 Trim32 is a positive regulator of ACD that acts against MYCN and should be considered as a tumor-suppressor candidate
24500717 BBS11 promotes accumulation of NPHP7, changing the properties of NPHP7. TRIM32 Modulates the Transcriptional Activities of Glis2
24381304 Deletions near the 3' terminus of ASTN2, a subset of these deletions also includes TRIM32, are significantly enriched in neurodevelopmental disorder subjects.
23444366 a novel connection between ubiquitylation and phosphorylation pathways, which could modulate a variety of cell events by stimulating the formation of the 14-3-3-TRIM32 signaling complex.
More...

AA Sequence

MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRI      1 - 70
TSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKE     71 - 140
AAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRKFFTGSL    141 - 210
AEVEKSNSQVVEEQSYLLNIAEVQAVSRCDYFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVEL    211 - 280
LKVGHVGPLQIGQAVKKPRTVNVEDSWAMEATASAASTSVTFREMDMSPEEVVASPRASPAKQRGPEAAS    281 - 350
NIQQCLFLKKMGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLS    351 - 420
FLGADLPNLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEG    421 - 490
GKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENRQNEHHLEGGFSIGSVGPDGQ    491 - 560
LGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGYSVLIREGLTCPVGIALTPKGQL    561 - 630
LVLDCWDHCIKIYSYHLRRYSTP                                                   631 - 653
//

Text Mined References (54)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26514622 2015 TRIM-NHL proteins in development and disease.
26394407 2015 SseK3 Is a Salmonella Effector That Binds TRIM32 and Modulates the Host's NF-?B Signalling Activity.
26057645 2015 TRIM32 Senses and Restricts Influenza A Virus by Ubiquitination of PB1 Polymerase.
25873391 2015 MicroRNA-155 Reinforces HIV Latency.
25416956 2014 A proteome-scale map of the human interactome network.
25351777 2015 Detection of TRIM32 deletions in LGMD patients analyzed by a combined strategy of CGH array and massively parallel sequencing.
25146927 2014 E3 ubiquitin ligase TRIM32 negatively regulates tumor suppressor p53 to promote tumorigenesis.
25100564 2014 Trim32 facilitates degradation of MYCN on spindle poles and induces asymmetric cell division in human neuroblastoma cells.
24500717 2014 Interaction with the Bardet-Biedl gene product TRIM32/BBS11 modifies the half-life and localization of Glis2/NPHP7.
More...