Property Summary

NCBI Gene PubMed Count 15
Grant Count 3
Funding $78,970.8
PubMed Score 9.85
PubTator Score 5.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

AA Sequence

MGPLSAPPCTQHITWKGLLLTASLLNFWNPPTTAQVTIEAQPPKVSEGKDVLLLVHNLPQNLTGHIWYKG      1 - 70
QIRDLYHYVTSYIVDGQIIKYGPAYSGRETVYSNASLLIQNVTQEDTGSYTLHIIKRGDGTGGVTGRFTF     71 - 140
TLYLETPKPSISSSNFNPREATEAVILTCDPETPDASYLWWMNGQSLPMTHSLQLSETNRTLYLFGVTNY    141 - 210
TAGPYECEIRNPVSASRSDPVTLNLLPKLPKPYITINNLNPRENKDVSTFTCEPKSENYTYIWWLNGQSL    211 - 280
PVSPRVKRRIENRILILPSVTRNETGPYQCEIRDRYGGIRSDPVTLNVLYGPDLPRIYPSFTYYHSGQNL    281 - 350
YLSCFADSNPPAQYSWTINGKFQLSGQKLSIPQITTKHSGLYACSVRNSATGKESSKSVTVRVSDWTLP     351 - 419
//

Text Mined References (15)

PMID Year Title
20116096 2010 Expression and transcriptional regulation of individual pregnancy-specific glycoprotein genes in differentiating trophoblast cells.
19562724 2009 The FOXF2 pathway in the human prostate stroma.
18792801 2009 Coordinate expression of the human pregnancy-specific glycoprotein gene family during induced and replicative senescence.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11501563 1999 Redefined nomenclature for members of the carcinoembryonic antigen family.
7851895 1994 Gene organization of the pregnancy-specific glycoprotein region on human chromosome 19: assembly and analysis of a 700-kb cosmid contig spanning the region.
7794280 1995 Characterization of cDNA encoding novel pregnancy-specific glycoprotein variants.
More...