Property Summary

NCBI Gene PubMed Count 76
Grant Count 1
Funding $249,459
PubMed Score 28.32
PubTator Score 15.11

Knowledge Summary

Patent (18,039)

Expression

Synonym

Accession Q13043 B2RCR8 Q15802 Q4G156 Q5H982 Q6PD60 Q9BR32 Q9NTZ4
Symbols KRS2
MST1
YSK3

Gene

 Grant Application (1)

PDB

4OH8   2JO8   3COM   4NR2  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (32)

PMID Text
26457732 STK4 was reduced in macrophages from human hepatoma patients and was inversely associated with the levels of IRAK1, IL-6, and phospho-p65 or phospho-STAT3. Serum STK4 levels were specifically decreased in HCC patients with high levels of IL-6.
26117625 Data indicate that two siblings with a serine/threonine kinase 4 (STK4) mutation with features of autosomal recessive (AR) hyperimmunoglobulin E syndrome and autoimmune cytopenias.
26116501 the kinase Mst1 controls selective CCR7-dependent functions in human mature dendritic cells.
25367221 The MST1/2-SAV1 complex, a core component of the Hippo pathway, promotes ciliogenesis.
24813251 Genetic inactivation of STK4 restores YAP1 levels, triggering cell death in hematologic malignancies.
24633305 Under diabetogenic conditions, MST1 was strongly activated in beta cells, and induced apoptosis via BIM upregulation, and impaired insulin secretion via phosphorylation of PDX1.
24393845 PHLPP1 is a binding protein for Mst1 and it modulates the Hippo pathway by dephosphorylating Mst1 at the inhibitory Thr(387) of Mst1.
24255178 Results indicate that changes in phosphorylation orchestrate interactions between kinases and phosphatases in Hippo (MST1/2 protein kinases) signaling, providing a putative mechanism for pathway regulation.
23647599 Inhibition of Mst1 kinase activation in cardiomyocytes protects against cell hypoxia.
23419720 Results indicated that Mst1 might be a promising anticancer target.
More...

AA Sequence

METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEI      1 - 70
IKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYL     71 - 140
HFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSL    141 - 210
GITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPF    211 - 280
VRSAKGVSILRDLINEAMDVKLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDG    281 - 350
ANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLK    351 - 420
NSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF       421 - 487
//

Text Mined References (91)

PMID Year Title
26457732 2015 STK4 regulates TLR pathways and protects against chronic inflammation-related hepatocellular carcinoma.
26117625 2015 STK4 (MST1) deficiency in two siblings with autoimmune cytopenias: A novel mutation.
26116501 2015 The Mammalian Sterile 20-like 1 Kinase Controls Selective CCR7-Dependent Functions in Human Dendritic Cells.
25367221 2014 The MST1/2-SAV1 complex of the Hippo pathway promotes ciliogenesis.
24813251 2014 Rescue of Hippo coactivator YAP1 triggers DNA damage-induced apoptosis in hematological cancers.
24633305 2014 MST1 is a key regulator of beta cell apoptosis and dysfunction in diabetes.
24393845 2014 PHLPP1 regulates contact inhibition by dephosphorylating Mst1 at the inhibitory site.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
More...