Property Summary

NCBI Gene PubMed Count 27
PubMed Score 5.27
PubTator Score 6.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.268 3.1e-04
oligodendroglioma -1.500 3.4e-02
osteosarcoma 1.453 3.7e-04
ovarian cancer 1.200 1.1e-02
pancreatic cancer 1.100 3.7e-02
pancreatic carcinoma 1.100 3.7e-02
psoriasis 1.100 1.8e-03

 GWAS Trait (1)

Gene RIF (5)

AA Sequence

MDELAGGGGGGPGMAAPPRQQQGPGGNLGLSPGGNGAAGGGGPPASEGAGPAAGPELSRPQQYTIPGILH      1 - 70
YIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLKYGTE     71 - 140
LNQGDLKMPTFESEETKDTEAPTAPQNSQLTWKQGRQLLRQYLQEVGYTDTILDVRSQRVRSLLGLSNSE    141 - 210
PNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNK    211 - 280
HKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDGEGAGEARSSGDGTEWDKDDLSPTAEVWDVDQGLISK    281 - 350
LKEQYKKERKGKKGVKRANRTKLYDMIADLGDDELPHIPSGIINQSRSASTRMTDHEGARAEEAEPITFP    351 - 420
SGGGKSFIMGSDDVLLSVLGLGDLADLTVTNDADYSYDLPANKDAFRKTWNPKYTLRSHFDGVRALAFHP    421 - 490
VEPVLVTASEDHTLKLWNLQKTVPAKKSASLDVEPIYTFRAHIGPVLSLAISSNGEQCFSGGIDATIQWW    491 - 560
NMPSPSVDPYDTYEPNVLAGTLVGHTDAVWGLAYSGIKNQLLSCSADGTVRLWNPQEKLPCICTYNGDKK    561 - 630
HGIPTSVDFIGCDPAHMVTSFNTGSAVIYDLETSQSLVILSSQVDSGLQSNNHINRVVSHPTLPVTITAH    631 - 700
EDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDE    701 - 770
SIYDVAFHSSKAYIASAGADALAKVFV                                               771 - 797
//

Text Mined References (40)

PMID Year Title