Property Summary

NCBI Gene PubMed Count 26
Grant Count 6
R01 Count 6
Funding $478,628
PubMed Score 3.91
PubTator Score 6.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic cancer 1.100 0.037
oligodendroglioma -1.500 0.034
psoriasis 1.100 0.002
osteosarcoma 1.453 0.000
acute quadriplegic myopathy 1.268 0.000
pancreatic carcinoma 1.100 0.037
ovarian cancer 1.200 0.011

Gene RIF (5)

PMID Text
26022125 results demonstrate that XBP1 mRNA splicing plays an important role in maintaining the function of bone marrow-derived macrophages and provide new insight into the study and treatment of atherosclerosis
25531779 this study propose that the STRIPAK complex, FAM40A, FAM40B and STRN3, regulates the mode of cancer cell migration by controlling the activity of MST3 and 4, which locally coordinate the phosphorylation of ERM proteins and inhibit the dephosphorylation of MLC leading to increased actin-membrane linkage.
25015106 The structure and protein-binding domains of the SG2NA protein variants have been described.
24550388 This result combined with a number of biophysical analyses provide evidence that the coiled coil domain of striatin 3 and the PP2A A subunit form a stable core complex with a 2:2 stoichiometry
23678272 STRN3 (rs2273171)is associated with single nucleotide polymorphisms in Korean patients, either non-segmental or segmental type.

AA Sequence

MDELAGGGGGGPGMAAPPRQQQGPGGNLGLSPGGNGAAGGGGPPASEGAGPAAGPELSRPQQYTIPGILH      1 - 70
YIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLKYGTE     71 - 140
LNQGDLKMPTFESEETKDTEAPTAPQNSQLTWKQGRQLLRQYLQEVGYTDTILDVRSQRVRSLLGLSNSE    141 - 210
PNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNK    211 - 280
HKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDGEGAGEARSSGDGTEWDKDDLSPTAEVWDVDQGLISK    281 - 350
LKEQYKKERKGKKGVKRANRTKLYDMIADLGDDELPHIPSGIINQSRSASTRMTDHEGARAEEAEPITFP    351 - 420
SGGGKSFIMGSDDVLLSVLGLGDLADLTVTNDADYSYDLPANKDAFRKTWNPKYTLRSHFDGVRALAFHP    421 - 490
VEPVLVTASEDHTLKLWNLQKTVPAKKSASLDVEPIYTFRAHIGPVLSLAISSNGEQCFSGGIDATIQWW    491 - 560
NMPSPSVDPYDTYEPNVLAGTLVGHTDAVWGLAYSGIKNQLLSCSADGTVRLWNPQEKLPCICTYNGDKK    561 - 630
HGIPTSVDFIGCDPAHMVTSFNTGSAVIYDLETSQSLVILSSQVDSGLQSNNHINRVVSHPTLPVTITAH    631 - 700
EDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDE    701 - 770
SIYDVAFHSSKAYIASAGADALAKVFV                                               771 - 797
//

Text Mined References (40)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26022125 2015 SG2NA enhances cancer cell survival by stabilizing DJ-1 and thus activating Akt.
25743393 2015 CCM-3/STRIPAK promotes seamless tube extension through endocytic recycling.
25531779 2015 STRIPAK components determine mode of cancer cell migration and metastasis.
25015106 2014 Molecular modeling and molecular dynamics simulations based structural analysis of the SG2NA protein variants.
24550388 2014 Striatins contain a noncanonical coiled coil that binds protein phosphatase 2A A subunit to form a 2:2 heterotetrameric core of striatin-interacting phosphatase and kinase (STRIPAK) complex.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23678272 2013 Three new single nucleotide polymorphisms identified by a genome-wide association study in Korean patients with vitiligo.
More...