Property Summary

NCBI Gene PubMed Count 14
PubMed Score 120.52
PubTator Score 41.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer -1.200 1.3e-03
colon cancer -1.800 3.1e-02
group 3 medulloblastoma -1.100 8.0e-03
intraductal papillary-mucinous neoplasm ... 2.300 7.5e-04
lung cancer -3.300 2.4e-06
lung carcinoma -2.800 8.4e-35
nasopharyngeal carcinoma -1.300 3.4e-04
ovarian cancer 1.300 1.3e-04
pancreatic cancer 1.900 1.4e-04
pancreatic ductal adenocarcinoma liver m... 2.050 2.0e-02
spina bifida -2.211 2.6e-02
urothelial carcinoma -2.000 5.0e-02

Synonym

Accession Q13021 B3KWR6 Q9BTU0
Symbols BENE

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MASPDPPATSYAPSDVPSGVALFLTIPFAFFLPELIFGFLVWTMVAATHIVYPLLQGWVMYVSLTSFLIS      1 - 70
LMFLLSYLFGFYKRFESWRVLDSLYHGTTGILYMSAAVLQVHATIVSEKLLDPRIYYINSAASFFAFIAT     71 - 140
LLYILHAFSIYYH                                                             141 - 153
//

Text Mined References (14)

PMID Year Title