Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
Funding $100,665
PubMed Score 115.21
PubTator Score 41.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
urothelial carcinoma -2.000 0.050
primary pancreatic ductal adenocarcinoma 2.468 0.022
intraductal papillary-mucinous neoplasm ... 2.300 0.001
colon cancer -1.900 0.000
lung cancer -4.900 0.000
pancreatic cancer 2.200 0.049
group 3 medulloblastoma -1.100 0.008
nasopharyngeal carcinoma -1.300 0.000
lung carcinoma -2.800 0.000
spina bifida -2.211 0.026
Breast cancer -1.200 0.001
ovarian cancer 1.300 0.000

Synonym

Accession Q13021 B3KWR6 Q9BTU0
Symbols BENE

Gene

PANTHER Protein Class (1)

 Grant Application (1)

 GO Process (1)

Gene RIF (3)

PMID Text
25496667 Genome-wide shRNA screening identifies MALL, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25401970 We report the unexpectedly common retinal involvement of NPHP type 1 with an additional MALL deletion in a Korean cohort.
18305945 in colonic serrated adenomas three genes (TNFRSF10A, BENE, RARA) with strongly significant expression intensities in the oligonucleotide microarray

AA Sequence

MASPDPPATSYAPSDVPSGVALFLTIPFAFFLPELIFGFLVWTMVAATHIVYPLLQGWVMYVSLTSFLIS      1 - 70
LMFLLSYLFGFYKRFESWRVLDSLYHGTTGILYMSAAVLQVHATIVSEKLLDPRIYYINSAASFFAFIAT     71 - 140
LLYILHAFSIYYH                                                             141 - 153
//

Text Mined References (14)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25401970 2015 Atypical retinopathy in patients with nephronophthisis type 1: an uncommon ophthalmological finding.
18305945 2008 Gene profiling of colonic serrated adenomas by using oligonucleotide microarray.
16341674 2005 Transcriptome analysis of human gastric cancer.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11294831 2001 BENE, a novel raft-associated protein of the MAL proteolipid family, interacts with caveolin-1 in human endothelial-like ECV304 cells.
9361039 1997 A novel gene that encodes a protein with a putative src homology 3 domain is a candidate gene for familial juvenile nephronophthisis.
More...