Property Summary

NCBI Gene PubMed Count 23
PubMed Score 17.49
PubTator Score 11.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 2.02522796271982E-11
adult high grade glioma 2148 1.7221528923185E-6
ovarian cancer 8492 3.42632120378006E-6
juvenile dermatomyositis 1189 4.33003069759343E-6
tuberculosis 1563 3.11527952243731E-5
atypical teratoid / rhabdoid tumor 4369 4.83663439799983E-5
Amyotrophic Lateral Sclerosis 432 1.63708476522588E-4
psoriasis 6685 2.38363562687582E-4
glioblastoma 5572 2.53749344956372E-4
Crohn's disease 304 8.2898380863972E-4
osteosarcoma 7933 0.0012982876434074
medulloblastoma, large-cell 6234 0.00158230402530105
medulloblastoma 1524 0.00166798593728782
gastric cancer 436 0.00186820886673402
Down syndrome 548 0.00225067213238855
ulcerative colitis 2087 0.00332201981205767
acute quadriplegic myopathy 1157 0.00451503394185634
primitive neuroectodermal tumor 3031 0.00482282830892335
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00611302787012132
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00732116289640061
invasive ductal carcinoma 2950 0.0080673454053078
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.0145510359346978
aldosterone-producing adenoma 664 0.0259408485379637
Breast cancer 3099 0.0259889637897627
spina bifida 1064 0.0281979925653595
hereditary spastic paraplegia 313 0.0288695167782796
ependymoma 2514 0.0314001938570557
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Kidney cancer 121 0.0 1.0

Expression

Synonym

Accession Q13017 A1L375 A1L376 A8KAA1 D3DS89 D3DS90 Q05BE8 Q05BU8 Q59ER0 Q6DHZ3
Symbols GFI2
p190-B
RhoGAP5
p190BRhoGAP

Gene

PDB

2EE4   2EE5  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (9)

PMID Text
25961434 This newly identified miR-744/ARHGAP5 pathway provides further insight into the progression and metastasis of NPC and indicates potential novel therapeutic targets for NPC.
24316134 Ectopic expression of p190B suppressed the miR-494-induced EGFR upregulation.
23653363 Data indicate a role for p120-catenin (amino acids 820-843) domain in the p120-catenin.p190RhoGAP signaling complex assembly and membrane targeting.
23552690 RhoA is down-regulated at cell-cell contacts via p190RhoGAP-B in response to tensional homeostasis.
23474761 The expression level of miR-486-5p was inversely correlated with that of ARHGAP5.
19822667 Results link Cdk5 to Rho-ROCK signaling via Src and p190RhoGAP and implicate Cdk5 in the regulation of cell contraction, attachment, and migration.
18996642 ARHGAP5 (the gene encoding p190-B RhoGAP) is a probable target for the amplification at 14q12, and p190-B RhoGAP promotes cells spreading and migration by negatively regulating RhoA activity in Huh-7 hepatocellular carcinoma cells
16469769 precise control of p190-B Rho GTPase-activating protein activity is critical for normal branching morphogenesis during mammary gland development
14610059 A cell cycle-regulated reduction in endogenous p190 levels is linked to completion of cytokinesis and generation of viable cell progeny.

AA Sequence

MMAKNKEPRPPSYTISIVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTIDFGGRVVNND      1 - 70
HFLYWGDIIQNSEDGVECKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAAASKLQSAEKLMYICTDQLGL     71 - 140
EQDFEQKQMPEGKLNVDGFLLCIDVSQGCNRKFDDQLKFVNNLFVQLSKSKKPVIIAATKCDECVDHYLR    141 - 210
EVQAFASNKKNLLVVETSARFNVNIETCFTALVQMLDKTRSKPKIIPYLDAYKTQRQLVVTATDKFEKLV    211 - 280
QTVRDYHATWKTVSNKLKNHPDYEEYINLEGTRKARNTFSKHIEQLKQEHIRKRREEYINTLPRAFNTLL    281 - 350
PNLEEIEHLNWSEALKLMEKRADFQLCFVVLEKTPWDETDHIDKINDRRIPFDLLSTLEAEKVYQNHVQH    351 - 420
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAYKYITEADSKEVYGRHQREIVEKAKEEF    421 - 490
QEMLFEHSELFYDLDLNATPSSDKMSEIHTVLSEEPRYKALQKLAPDRESLLLKHIGFVYHPTKETCLSG    491 - 560
QNCTDIKVEQLLASSLLQLDHGRLRLYHDSTNIDKVNLFILGKDGLAQELANEIRTQSTDDEYALDGKIY    561 - 630
ELDLRPVDAKSPYFLSQLWTAAFKPHGCFCVFNSIESLSFIGEFIGKIRTEASQIRKDKYMANLPFTLIL    631 - 700
ANQRDSISKNLPILRHQGQQLANKLQCPFVDVPAGTYPRKFNETQIKQALRGVLESVKHNLDVVSPIPAN    701 - 770
KDLSEADLRIVMCAMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI    771 - 840
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKELMTEGEHIATE    841 - 910
ITAKFTALYSLSQYHRQTEVFTLFFSDVLEKKNMIENSYLSDNTRESTHQSEDVFLPSPRDCFPYNNYPD    911 - 980
SDDDTEAPPPYSPIGDDVQLLPTPSDRSRYRLDLEGNEYPIHSTPNCHDHERNHKVPPPIKPKPVVPKTN    981 - 1050
VKKLDPNLLKTIEAGIGKNPRKQTSRVPLAHPEDMDPSDNYAEPIDTIFKQKGYSDEIYVVPDDSQNRIK   1051 - 1120
IRNSFVNNTQGDEENGFSDRTSKSHGERRPSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKG   1121 - 1190
RHRGSEEDPLLSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNYF   1191 - 1260
GMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNINLVSMEVTVNAV   1261 - 1330
AGALKAFFADLPDPLIPYSLHPELLEAAKIPDKTERLHALKEIVKKFHPVNYDVFRYVITHLNRVSQQHK   1331 - 1400
INLMTADNLSICFWPTLMRPDFENREFLSTTKIHQSVVETFIQQCQFFFYNGEIVETTNIVAPPPPSNPG   1401 - 1470
QLVEPMVPLQLPPPLQPQLIQPQLQTDPLGII                                         1471 - 1502
//

Text Mined References (33)

PMID Year Title
25961434 2015 MiR-744 functions as a proto-oncogene in nasopharyngeal carcinoma progression and metastasis via transcriptional control of ARHGAP5.
24316134 2014 Ionizing radiation-inducible miR-494 promotes glioma cell invasion through EGFR stabilization by targeting p190B rhoGAP.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23653363 2013 Interaction of p190RhoGAP with C-terminal domain of p120-catenin modulates endothelial cytoskeleton and permeability.
23622247 2013 14-3-3 proteins interact with a hybrid prenyl-phosphorylation motif to inhibit G proteins.
23552690 2013 RhoA is down-regulated at cell-cell contacts via p190RhoGAP-B in response to tensional homeostasis.
23474761 2014 Downregulation of miR-486-5p contributes to tumor progression and metastasis by targeting protumorigenic ARHGAP5 in lung cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...