Property Summary

NCBI Gene PubMed Count 15
PubMed Score 20.57
PubTator Score 18.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Synonym

Accession Q13015
Symbols AF1Q

Gene

Gene RIF (10)

PMID Text
26341630 Results demonstrate that AF1q gene transcription is regulated by REST through direct binding at -383 to -363 bp of AF1q promoter.
26079538 Findings indicate that breast cancer cells with a hyperactive AF1q/TCF7/CD44 regulatory axis in the primary sites may represent "metastatic founder cells" which have invasive properties.
24880125 AF1Q had a KFERQ-like motif.
22761939 AF1q plays a role in the onset of basal apoptosis in ovarian cancer cells, thus providing new information about the activity of this protein whose biologic functions are mostly unknown
21715312 Using in vitro assays based on either forced expression or shRNA-mediated silencing of AF1q, the study provides evidence that the protein promotes T- over B-cell differentiation in multipotent hematopoietic progenitors.
20596645 AF1q up-regulation of BAD is through its effect on NF-kappaB and this may hint of its oncogenic mechanism in cancer.
19396856 high AF1q expression is a poor prognostic marker for adult patients with normal cytogenetics acute myeloid leukemia
18852119 The study provides the first evidence that AF1q plays a critical role in the regulation of apoptosis and drug resistance.
17929166 overexpression of AF1Q leads to more progression in human breast cancer
15530661 The ectopic expression of human AF1q triggered the expression of the neuronal marker TuJ1 in non-neuronal human embryonic kidney (HEK) cells.

AA Sequence

MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYS      1 - 70
TFNFWRAPIASIHSFELDLL                                                       71 - 90
//

Text Mined References (16)

PMID Year Title
26341630 2015 RE1 silencing transcription factor (REST) negatively regulates ALL1-fused from chromosome 1q (AF1q) gene transcription.
26079538 2015 AF1q is a novel TCF7 co-factor which activates CD44 and promotes breast cancer metastasis.
24880125 2014 Degradation of AF1Q by chaperone-mediated autophagy.
22761939 2012 AF1q: a novel mediator of basal and 4-HPR-induced apoptosis in ovarian cancer cells.
21715312 2011 AF1q/MLLT11 regulates the emergence of human prothymocytes through cooperative interaction with the Notch signaling pathway.
21269460 2011 Initial characterization of the human central proteome.
20596645 2010 AF1q enhancement of gamma irradiation-induced apoptosis by up-regulation of BAD expression via NF-kappaB in human squamous carcinoma A431 cells.
19396856 2009 Elevated AF1q expression is a poor prognostic marker for adult acute myeloid leukemia patients with normal cytogenetics.
18852119 2008 Oncogene AF1q enhances doxorubicin-induced apoptosis through BAD-mediated mitochondrial apoptotic pathway.
17929166 2008 Identification of the functional role of AF1Q in the progression of breast cancer.
More...