Property Summary

NCBI Gene PubMed Count 16
PubMed Score 21.28
PubTator Score 14.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (4)

AA Sequence

MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHV      1 - 70
QLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISW     71 - 140
YLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQ    141 - 210
RLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLL    211 - 280
YSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL                          281 - 328
//

Text Mined References (22)

PMID Year Title