Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
R01 Count 5
Funding $2,191,745
PubMed Score 21.21
PubTator Score 14.06

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q13011 A8K745 Q8WVX0 Q96EZ9
Symbols HPXEL

Gene

PANTHER Protein Class (2)

PDB

2VRE  

Gene RIF (4)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
17676665 HIV-1 gp120 upregulates the expression of enoyl Coenzyme A hydratase 1 in umbilical cord blood mononuclear cells and T-cell lines
16615866 Polymorphism of delta3,5-delta2,4-dienoyl-coenzyme A isomerase (the ECH1 gene product protein) in human striated muscle tissue
7558027 Possible roles for the ECH1 protein product in peroxisomal beta-oxidation are discussed.

AA Sequence

MAAGIVASRRLRDLLTRRLTGSNYPGLSISLRLTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHV      1 - 70
QLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISW     71 - 140
YLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQ    141 - 210
RLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLL    211 - 280
YSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL                          281 - 328
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20178365 2010 A proteome-wide perspective on peroxisome targeting signal 1(PTS1)-Pex5p affinities.
More...