Property Summary

NCBI Gene PubMed Count 124
Grant Count 81
R01 Count 63
Funding $4,790,518.38
PubMed Score 174.67
PubTator Score 169.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession Q13009 B7ZLR6 F5GZ53 Q17RT7 TIAM-1
Symbols

Gene

PDB

4NXR   4GVC   4GVD   4NXQ   2D8I   3KZD   3KZE   4K2O   4K2P   4NXP  

Gene RIF (89)

PMID Text
26884821 Tiam1 expression significantly increased in cholangiocarcinoma tissues, and increased along with the degree of malignancy of cholangiocarcinoma. Targeted silencing Tiam1 expression could inhibit proliferation and migration activity of cholangiocarcinoma cells.
26821678 fibroblast expression patterns of Tiam1 and osteopontin in human breast cancers show converse changes correlating with invasion, supporting the hypothesis that this pathway in tumor-associated fibroblasts regulates breast cancer invasiveness
26575881 The polymorphisms rs2833188 and rs2833195 in TIAM1 gene may be associated with some clinical characteristics in children with Kawasaki disease.
25973950 The downregulation of MiR-182 is associated with the growth and invasion of osteosarcoma cells through the regulation of TIAM1 expression.
25746002 Study identifies a bidirectional (phosphorylation and dephosphorylation) regulatory mechanism controlling Tiam1 stability and provides new insights on how EGFR signaling triggers Rac1 activation and cancer development.
25684205 Heterodimeric CUL3 proteinubiquitylates TIAM1.CUL3 regulates TIAM1 abundance and subsequent RAC1 signaling.
25672412 These results suggested that Tiam1 overexpression in LSCC is possibly involved in the promotion of migration and invasion, and is a promising therapeutic target in the prevention of the progression of LSCC.
25654811 We identified T lymphoma invasion and metastasis 1 (TIAM1) gene as potential target of miR-329 in gastric cancer
25543140 we show that HUWE1 stimulates human lung cancer cell invasion through regulating TIAM1 stability. Finally, we demonstrate that HUWE1 and TIAM1 protein levels are inversely correlated in human lung carcinomas
25124033 Degradation of Tiam1 by casein kinase 1 and the SCFbetaTrCP ubiquitin ligase controls the duration of mTOR-S6K signaling.
More...

AA Sequence

MGNAESQHVEHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKVIHRNSEVSTRSSSTPSIPQSLAE      1 - 70
NGLEPFSQDGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTAASVQSMPDTEESRLYGDDAT     71 - 140
YLAEGGRRQHSYTSNGPTFMETASFKKKRSKSADIWREDSLEFSLSDLSQEHLTSNEEILGSAEEKDCEE    141 - 210
ARGMETRASPRQLSTCQRANSLGDLYAQKNSGVTANGGPGSKFAGYCRNLVSDIPNLANHKMPPAAAEET    211 - 280
PPYSNYNTLPCRKSHCLSEGATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRS    281 - 350
NATNSSYSPTTGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP    351 - 420
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESDGRSGIDHNSI    421 - 490
PKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWITAIHSACATAVARHHHKEDTL    491 - 560
RLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTILDQIFVWEQNLEQFQMDLFRFRCYLASLQG    561 - 630
GELPNPKRLLAFASRPTKVAMGRLGIFSVSSFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLD    631 - 700
TTSKKKQGRPSINQVFGEGTEAVKKSLEGIFDDIVPDGKREKEVVLPNVHQHNPDCDIWVHEYFTPSWFC    701 - 770
LPNNQPALTVVRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQLYVPQPEEDIYELLYKEIEICP    771 - 840
KVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSM    841 - 910
LKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTSNPGHSLCSEQGSSAETAPEE    911 - 980
TEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDQSPSPQDSTGPQLATMRQLSDADKLRKVICELLE    981 - 1050
TERTYVKDLNCLMERYLKPLQKETFLTQDELDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQ   1051 - 1120
FKKVLFSLGGSFLYYADRFKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSSTLESYLIKPI   1121 - 1190
QRILKYPLLLRELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA   1191 - 1260
DLSMGDLLLHTTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRLSIYEDWDPFR   1261 - 1330
FRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSPESRKDFLKAVHSILRDKHRR   1331 - 1400
QLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPSKSLGRRRRRLARNRFTIDSDAVSASSPEKE   1401 - 1470
SQQPPGGGDTDRWVEEQFDLAQYEEQDDIKETDILSDDDEFCESVKGASVDRDLQERLQATSISQRERGR   1471 - 1540
KTLDSHASRMAQLKKQAALSGINGGLESASEEVIWVRREDFAPSRKLNTEI                      1541 - 1591
//

Text Mined References (133)

PMID Year Title
26884821 2015 Biological effects of RNAi targeted inhibiting Tiam1 gene expression on cholangiocarcinoma cells.
26821678 2016 The fibroblast Tiam1-osteopontin pathway modulates breast cancer invasion and metastasis.
26575881 2015 [Association of TIAM1 gene polymorphisms with Kawasaki disease and its clinical characteristics].
25973950 2015 The Downregulation of MiR-182 Is Associated with the Growth and Invasion of Osteosarcoma Cells through the Regulation of TIAM1 Expression.
25746002 2015 An EGFR/PI3K/AKT axis promotes accumulation of the Rac1-GEF Tiam1 that is critical in EGFR-driven tumorigenesis.
25684205 2015 CUL3-KBTBD6/KBTBD7 ubiquitin ligase cooperates with GABARAP proteins to spatially restrict TIAM1-RAC1 signaling.
25672412 2015 Overexpression of Tiam1 promotes the progression of laryngeal squamous cell carcinoma.
25654811 2015 By downregulating TIAM1 expression, microRNA-329 suppresses gastric cancer invasion and growth.
25543140 2015 HUWE1 ubiquitylates and degrades the RAC activator TIAM1 promoting cell-cell adhesion disassembly, migration, and invasion.
25124033 2014 Degradation of Tiam1 by casein kinase 1 and the SCF?TrCP ubiquitin ligase controls the duration of mTOR-S6K signaling.
More...